Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BRR4

Protein Details
Accession H6BRR4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKKFRTGRKWLKAKLRRGCSESHydrophilic
NLS Segment(s)
PositionSequence
8-14RKWLKAK
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MKKFRTGRKWLKAKLRRGCSESQKQDRKIVIGPPTNFRRENITLGKDVDGNAILIERAREDAQAMHRASQTQLRSDTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.8
4 0.75
5 0.75
6 0.73
7 0.75
8 0.74
9 0.75
10 0.74
11 0.71
12 0.72
13 0.65
14 0.58
15 0.5
16 0.45
17 0.42
18 0.4
19 0.38
20 0.39
21 0.42
22 0.44
23 0.41
24 0.36
25 0.36
26 0.31
27 0.34
28 0.31
29 0.3
30 0.27
31 0.28
32 0.28
33 0.21
34 0.19
35 0.15
36 0.11
37 0.09
38 0.07
39 0.06
40 0.06
41 0.05
42 0.06
43 0.05
44 0.07
45 0.08
46 0.08
47 0.09
48 0.12
49 0.17
50 0.24
51 0.25
52 0.26
53 0.26
54 0.28
55 0.29
56 0.32
57 0.3
58 0.29