Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6BW05

Protein Details
Accession H6BW05    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-140VAPTRHKAKEVKRRTKTGCLTCRKRRIKVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSTAALQQSSTASISLPPISSIDFHTHLAQQRSSEDVVQPLPPPPPAAPRVLPPLPYPYAAARPAPPPPPPPPMAHEYMHARPIYPGIPSSYQPMPARIPLPSTTDPNLIVAPTRHKAKEVKRRTKTGCLTCRKRRIKVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.12
5 0.12
6 0.13
7 0.13
8 0.15
9 0.17
10 0.18
11 0.19
12 0.2
13 0.24
14 0.28
15 0.31
16 0.29
17 0.26
18 0.25
19 0.26
20 0.26
21 0.23
22 0.18
23 0.17
24 0.17
25 0.17
26 0.17
27 0.16
28 0.16
29 0.15
30 0.16
31 0.15
32 0.18
33 0.19
34 0.22
35 0.21
36 0.23
37 0.29
38 0.28
39 0.29
40 0.25
41 0.28
42 0.25
43 0.25
44 0.24
45 0.18
46 0.2
47 0.2
48 0.2
49 0.17
50 0.17
51 0.2
52 0.21
53 0.22
54 0.22
55 0.25
56 0.28
57 0.29
58 0.29
59 0.29
60 0.3
61 0.32
62 0.28
63 0.27
64 0.28
65 0.27
66 0.29
67 0.25
68 0.22
69 0.18
70 0.19
71 0.17
72 0.12
73 0.12
74 0.11
75 0.13
76 0.13
77 0.17
78 0.17
79 0.22
80 0.22
81 0.24
82 0.23
83 0.23
84 0.24
85 0.2
86 0.22
87 0.19
88 0.25
89 0.24
90 0.27
91 0.26
92 0.27
93 0.27
94 0.25
95 0.24
96 0.17
97 0.17
98 0.15
99 0.19
100 0.22
101 0.27
102 0.26
103 0.3
104 0.38
105 0.46
106 0.55
107 0.61
108 0.67
109 0.7
110 0.79
111 0.82
112 0.84
113 0.84
114 0.83
115 0.82
116 0.82
117 0.84
118 0.85
119 0.89
120 0.88