FuNGI

H6C8J2

Protein Details

Accession

H6C8J2

Localization Confidence

High

Confidence Score

16.8

NoLS Segment(s)

Position	Sequence	Protein Nature
1-55	MVKSFSKSKRTPVRLRHKIEKASAAKQRKLKKEAKKNPQWKSRLKKDPGIPNLFP	Hydrophilic
79-98	RDAAKDKKKTGKDQPTNEAP	Hydrophilic

NLS Segment(s)

Position	Sequence
7-50	KSKRTPVRLRHKIEKASAAKQRKLKKEAKKNPQWKSRLKKDPGI
66-88	EKKRQKAEQAQRLRDAAKDKKKT

Subcellular Location(s)

nucl 13, mito 10, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR030378 G_CP_dom IPR014813 Gnl3_N_dom IPR006073 GTP-bd IPR023179 GTP-bd_ortho_bundle_sf IPR027417 P-loop_NTPase
Gene Ontology	GO:0005525 F:GTP binding
Pfam	View protein in Pfam PF08701 GN3L_Grn1 PF01926 MMR_HSR1
PROSITE	View protein in PROSITE PS51721 G_CP
CDD	cd04178 Nucleostemin_like

Amino Acid Sequences

MVKSFSKSKRTPVRLRHKIEKASAAKQRKLKKEAKKNPQWKSRLKKDPGIPNLFPFKEKILEEIEEKKRQKAEQAQRLRDAAKDKKKTGKDQPTNEAPEHDEDDLMDEDDDDLLEDEEMDEDDTADATNPLAALVASAQARAAEFDKGALEGDLASDSDEDDEAGVQLSETVAVDHRNPDQSRKAFDKIFKQVLDAADVVLYVLDARDPEGTRSREVERQVMSAEGGSKRLILVLNKIDLVPPPVLKGWLTHLRRYFPTIPLRASTPASNAQTFDHKQLTLKATSETLLRALKSYAASKQLKRSISVGVIGYPNVGKSSVINALTSRLNKGTQSFACPVGSEAGVTTSLREVKVDSKLKILDSPGIVFPSTVDGENKQDRERRRAEHEARLILLNALPPKQISDPIPAVNLLMSRLSTSPALYEKLLGHYGVVALGPFAHGDTTNDFLVQVARKRGRLGRGGVPNLNAAAMTVITDWRDGRIQGWVDPPVLKVTDDTEMAVAEGGDKAAAVGADHKVIVKEWAAEFKLEGLWGDGEDSKTDSAANDAMQVES

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.84
2	0.89
3	0.89
4	0.87
5	0.86
6	0.81
7	0.81
8	0.76
9	0.74
10	0.75
11	0.74
12	0.72
13	0.72
14	0.75
15	0.75
16	0.78
17	0.78
18	0.8
19	0.82
20	0.86
21	0.89
22	0.9
23	0.91
24	0.92
25	0.92
26	0.91
27	0.9
28	0.9
29	0.89
30	0.89
31	0.86
32	0.85
33	0.83
34	0.84
35	0.84
36	0.82
37	0.73
38	0.68
39	0.7
40	0.62
41	0.54
42	0.46
43	0.39
44	0.36
45	0.34
46	0.31
47	0.27
48	0.28
49	0.31
50	0.38
51	0.43
52	0.47
53	0.48
54	0.51
55	0.51
56	0.51
57	0.56
58	0.57
59	0.6
60	0.61
61	0.7
62	0.71
63	0.71
64	0.73
65	0.64
66	0.58
67	0.55
68	0.55
69	0.55
70	0.57
71	0.59
72	0.65
73	0.71
74	0.76
75	0.78
76	0.8
77	0.79
78	0.78
79	0.8
80	0.8
81	0.77
82	0.69
83	0.6
84	0.51
85	0.45
86	0.4
87	0.32
88	0.23
89	0.18
90	0.2
91	0.18
92	0.16
93	0.12
94	0.09
95	0.09
96	0.09
97	0.09
98	0.06
99	0.06
100	0.05
101	0.05
102	0.05
103	0.05
104	0.05
105	0.06
106	0.06
107	0.05
108	0.05
109	0.05
110	0.05
111	0.05
112	0.06
113	0.05
114	0.05
115	0.05
116	0.05
117	0.05
118	0.05
119	0.04
120	0.04
121	0.04
122	0.07
123	0.07
124	0.07
125	0.07
126	0.07
127	0.07
128	0.09
129	0.1
130	0.08
131	0.08
132	0.09
133	0.09
134	0.09
135	0.09
136	0.08
137	0.07
138	0.05
139	0.06
140	0.06
141	0.05
142	0.05
143	0.05
144	0.05
145	0.05
146	0.05
147	0.05
148	0.05
149	0.05
150	0.04
151	0.05
152	0.04
153	0.04
154	0.04
155	0.04
156	0.04
157	0.04
158	0.04
159	0.05
160	0.06
161	0.07
162	0.1
163	0.12
164	0.19
165	0.2
166	0.25
167	0.32
168	0.34
169	0.39
170	0.41
171	0.44
172	0.41
173	0.45
174	0.48
175	0.47
176	0.5
177	0.44
178	0.4
179	0.39
180	0.35
181	0.33
182	0.24
183	0.17
184	0.11
185	0.11
186	0.1
187	0.06
188	0.05
189	0.03
190	0.03
191	0.03
192	0.03
193	0.04
194	0.07
195	0.07
196	0.1
197	0.17
198	0.19
199	0.21
200	0.24
201	0.26
202	0.28
203	0.29
204	0.32
205	0.26
206	0.25
207	0.24
208	0.21
209	0.18
210	0.14
211	0.16
212	0.11
213	0.11
214	0.1
215	0.09
216	0.09
217	0.1
218	0.11
219	0.09
220	0.13
221	0.14
222	0.14
223	0.15
224	0.15
225	0.14
226	0.13
227	0.14
228	0.11
229	0.1
230	0.1
231	0.1
232	0.11
233	0.1
234	0.1
235	0.14
236	0.22
237	0.24
238	0.27
239	0.3
240	0.32
241	0.33
242	0.39
243	0.36
244	0.33
245	0.37
246	0.35
247	0.34
248	0.32
249	0.33
250	0.28
251	0.27
252	0.22
253	0.17
254	0.19
255	0.2
256	0.2
257	0.18
258	0.17
259	0.21
260	0.22
261	0.22
262	0.19
263	0.17
264	0.18
265	0.21
266	0.23
267	0.19
268	0.18
269	0.16
270	0.15
271	0.15
272	0.15
273	0.11
274	0.11
275	0.11
276	0.1
277	0.1
278	0.1
279	0.11
280	0.12
281	0.13
282	0.13
283	0.2
284	0.24
285	0.26
286	0.33
287	0.37
288	0.37
289	0.37
290	0.36
291	0.3
292	0.26
293	0.26
294	0.19
295	0.15
296	0.14
297	0.13
298	0.12
299	0.09
300	0.08
301	0.07
302	0.07
303	0.05
304	0.05
305	0.08
306	0.11
307	0.12
308	0.12
309	0.12
310	0.14
311	0.17
312	0.17
313	0.16
314	0.14
315	0.14
316	0.15
317	0.16
318	0.2
319	0.18
320	0.22
321	0.22
322	0.22
323	0.22
324	0.21
325	0.2
326	0.16
327	0.15
328	0.1
329	0.08
330	0.07
331	0.08
332	0.07
333	0.07
334	0.07
335	0.09
336	0.09
337	0.09
338	0.1
339	0.13
340	0.22
341	0.26
342	0.25
343	0.27
344	0.28
345	0.29
346	0.3
347	0.27
348	0.22
349	0.18
350	0.19
351	0.16
352	0.16
353	0.15
354	0.13
355	0.12
356	0.12
357	0.12
358	0.11
359	0.11
360	0.11
361	0.17
362	0.22
363	0.24
364	0.25
365	0.3
366	0.34
367	0.42
368	0.47
369	0.46
370	0.49
371	0.58
372	0.6
373	0.63
374	0.64
375	0.58
376	0.52
377	0.48
378	0.4
379	0.3
380	0.25
381	0.18
382	0.15
383	0.13
384	0.13
385	0.12
386	0.14
387	0.14
388	0.17
389	0.17
390	0.21
391	0.23
392	0.23
393	0.24
394	0.22
395	0.21
396	0.18
397	0.16
398	0.11
399	0.09
400	0.08
401	0.08
402	0.09
403	0.1
404	0.1
405	0.1
406	0.11
407	0.13
408	0.15
409	0.14
410	0.16
411	0.15
412	0.18
413	0.19
414	0.16
415	0.14
416	0.12
417	0.12
418	0.1
419	0.09
420	0.06
421	0.04
422	0.04
423	0.05
424	0.04
425	0.04
426	0.05
427	0.05
428	0.07
429	0.09
430	0.12
431	0.12
432	0.12
433	0.12
434	0.12
435	0.15
436	0.18
437	0.2
438	0.27
439	0.3
440	0.32
441	0.37
442	0.42
443	0.45
444	0.48
445	0.49
446	0.48
447	0.53
448	0.57
449	0.55
450	0.51
451	0.45
452	0.38
453	0.33
454	0.24
455	0.15
456	0.1
457	0.07
458	0.06
459	0.06
460	0.07
461	0.07
462	0.09
463	0.09
464	0.11
465	0.13
466	0.13
467	0.13
468	0.19
469	0.2
470	0.22
471	0.26
472	0.26
473	0.26
474	0.27
475	0.27
476	0.24
477	0.23
478	0.2
479	0.16
480	0.17
481	0.18
482	0.17
483	0.17
484	0.14
485	0.13
486	0.13
487	0.12
488	0.09
489	0.07
490	0.07
491	0.06
492	0.05
493	0.05
494	0.05
495	0.05
496	0.05
497	0.05
498	0.08
499	0.09
500	0.1
501	0.11
502	0.12
503	0.12
504	0.13
505	0.15
506	0.14
507	0.17
508	0.17
509	0.24
510	0.24
511	0.24
512	0.24
513	0.23
514	0.22
515	0.18
516	0.17
517	0.12
518	0.12
519	0.11
520	0.13
521	0.14
522	0.14
523	0.15
524	0.17
525	0.15
526	0.14
527	0.15
528	0.13
529	0.13
530	0.14
531	0.13
532	0.15

H6C8J2

3D AlphaFold-predicted Structure Viewer