Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6C9H4

Protein Details
Accession H6C9H4   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-38KIPWRLSPMQKARQRKRLKLVDKVHydrophilic
75-103KYTIYDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
82-94KEKKYRKGIHKLP
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFRPTAPLSGGLLWKIPWRLSPMQKARQRKRLKLVDKVVDTVSVALQNNGGMTAKAVERWYKEMPREEEMLPKDKYTIYDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.18
5 0.23
6 0.3
7 0.36
8 0.46
9 0.51
10 0.59
11 0.66
12 0.74
13 0.77
14 0.79
15 0.82
16 0.8
17 0.81
18 0.81
19 0.81
20 0.79
21 0.79
22 0.76
23 0.68
24 0.62
25 0.52
26 0.42
27 0.35
28 0.25
29 0.17
30 0.12
31 0.1
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.07
44 0.09
45 0.1
46 0.15
47 0.19
48 0.21
49 0.25
50 0.31
51 0.33
52 0.34
53 0.36
54 0.32
55 0.35
56 0.34
57 0.36
58 0.3
59 0.27
60 0.25
61 0.23
62 0.25
63 0.26
64 0.31
65 0.29
66 0.39
67 0.44
68 0.53
69 0.62
70 0.67
71 0.7
72 0.73
73 0.79
74 0.8
75 0.86
76 0.86
77 0.87
78 0.88
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.77
88 0.79