Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BS84

Protein Details
Accession H6BS84    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
171-197LEPGSSKVDKTPRRKKPWEKDAAENVDHydrophilic
NLS Segment(s)
PositionSequence
184-185RK
Subcellular Location(s) cyto_nucl 13.833, nucl 13.5, cyto 10, mito_nucl 7.832
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MDSSSAAEHDPSTAVEMPPATSDAIYRHLRSYPFDTDEEYQAGLSAILGHPETPATPEELEEKAELVLQTRCFYFARKFNIGPIDPVAYSAWVHAHGEPHHLPVAEPPHAHTAEETSSSTAQTSSAQPPTETSSSEPEPEPPYPTSFAAIVDLITRNIPIPGIEQIPDTVLEPGSSKVDKTPRRKKPWEKDAAENVDQPANASEGPSAQGEQPESTTKPVDVNGIKETGQGVVNILKPNAVSESNLLSKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.16
5 0.16
6 0.17
7 0.13
8 0.11
9 0.12
10 0.12
11 0.19
12 0.22
13 0.23
14 0.24
15 0.27
16 0.29
17 0.33
18 0.37
19 0.36
20 0.36
21 0.35
22 0.37
23 0.36
24 0.37
25 0.33
26 0.27
27 0.2
28 0.17
29 0.16
30 0.11
31 0.08
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.09
42 0.1
43 0.1
44 0.11
45 0.13
46 0.14
47 0.15
48 0.13
49 0.13
50 0.11
51 0.12
52 0.11
53 0.11
54 0.13
55 0.13
56 0.14
57 0.13
58 0.16
59 0.15
60 0.18
61 0.22
62 0.25
63 0.31
64 0.35
65 0.35
66 0.37
67 0.43
68 0.4
69 0.35
70 0.3
71 0.25
72 0.2
73 0.21
74 0.18
75 0.12
76 0.11
77 0.1
78 0.09
79 0.08
80 0.09
81 0.08
82 0.11
83 0.11
84 0.16
85 0.17
86 0.18
87 0.18
88 0.17
89 0.17
90 0.17
91 0.21
92 0.18
93 0.17
94 0.17
95 0.2
96 0.2
97 0.2
98 0.17
99 0.15
100 0.13
101 0.15
102 0.13
103 0.1
104 0.1
105 0.1
106 0.1
107 0.08
108 0.08
109 0.08
110 0.1
111 0.12
112 0.14
113 0.14
114 0.14
115 0.15
116 0.19
117 0.18
118 0.16
119 0.15
120 0.16
121 0.17
122 0.19
123 0.18
124 0.16
125 0.19
126 0.19
127 0.21
128 0.18
129 0.19
130 0.19
131 0.2
132 0.18
133 0.15
134 0.14
135 0.12
136 0.11
137 0.09
138 0.08
139 0.08
140 0.07
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.05
147 0.06
148 0.08
149 0.09
150 0.09
151 0.1
152 0.1
153 0.1
154 0.1
155 0.09
156 0.08
157 0.07
158 0.07
159 0.08
160 0.08
161 0.11
162 0.11
163 0.11
164 0.15
165 0.24
166 0.32
167 0.42
168 0.52
169 0.6
170 0.7
171 0.8
172 0.86
173 0.88
174 0.91
175 0.91
176 0.85
177 0.83
178 0.82
179 0.79
180 0.7
181 0.61
182 0.52
183 0.43
184 0.38
185 0.3
186 0.21
187 0.15
188 0.13
189 0.11
190 0.1
191 0.08
192 0.1
193 0.1
194 0.11
195 0.1
196 0.13
197 0.14
198 0.14
199 0.16
200 0.19
201 0.19
202 0.21
203 0.21
204 0.2
205 0.2
206 0.2
207 0.25
208 0.24
209 0.26
210 0.26
211 0.26
212 0.26
213 0.25
214 0.24
215 0.19
216 0.17
217 0.14
218 0.13
219 0.15
220 0.19
221 0.2
222 0.2
223 0.19
224 0.18
225 0.2
226 0.21
227 0.18
228 0.16
229 0.16
230 0.22