Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6BUG6

Protein Details
Accession H6BUG6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
248-270WELGRCCWRRSRGWRRSRNRRGCHydrophilic
NLS Segment(s)
PositionSequence
261-265WRRSR
Subcellular Location(s) plas 27
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDMHAEDIEMDDYSEQNEAFLQSTATWTRPVRASSAPVNGLAVYMKTKYNRLCRRLARSSFGTSIYWIIMILGFLVFALFVSALVFLTVYIWIHSIELIRVHTSPAITCPPCPTTSRVFTPSLPYTAPASHKSAPLGMLHPANRPFLPENPHYHDDGSSAPSRPVYNASDHEGNLARCASNLNQRLWGGPNTFKATKDMEFVLLLCQYAVYKALEDLFPPPAAPGQGRKPWKVFLVAVSALLGVWLLWELGRCCWRRSRGWRRSRNRRGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.08
5 0.09
6 0.1
7 0.1
8 0.1
9 0.09
10 0.13
11 0.15
12 0.16
13 0.2
14 0.2
15 0.24
16 0.27
17 0.28
18 0.29
19 0.3
20 0.34
21 0.34
22 0.38
23 0.35
24 0.31
25 0.31
26 0.26
27 0.23
28 0.19
29 0.14
30 0.11
31 0.11
32 0.14
33 0.16
34 0.22
35 0.29
36 0.39
37 0.48
38 0.51
39 0.59
40 0.64
41 0.71
42 0.75
43 0.72
44 0.68
45 0.63
46 0.63
47 0.55
48 0.49
49 0.4
50 0.31
51 0.28
52 0.21
53 0.16
54 0.11
55 0.09
56 0.07
57 0.06
58 0.05
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.03
66 0.02
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.08
85 0.08
86 0.09
87 0.09
88 0.1
89 0.1
90 0.1
91 0.1
92 0.11
93 0.16
94 0.15
95 0.16
96 0.18
97 0.19
98 0.21
99 0.22
100 0.23
101 0.23
102 0.26
103 0.29
104 0.3
105 0.3
106 0.29
107 0.33
108 0.31
109 0.27
110 0.23
111 0.2
112 0.18
113 0.18
114 0.2
115 0.17
116 0.2
117 0.2
118 0.21
119 0.2
120 0.19
121 0.18
122 0.16
123 0.15
124 0.12
125 0.13
126 0.13
127 0.16
128 0.17
129 0.17
130 0.16
131 0.18
132 0.18
133 0.18
134 0.23
135 0.23
136 0.28
137 0.33
138 0.35
139 0.33
140 0.32
141 0.29
142 0.25
143 0.22
144 0.2
145 0.15
146 0.14
147 0.14
148 0.14
149 0.14
150 0.14
151 0.16
152 0.15
153 0.16
154 0.18
155 0.21
156 0.22
157 0.22
158 0.23
159 0.23
160 0.21
161 0.19
162 0.17
163 0.13
164 0.11
165 0.13
166 0.13
167 0.19
168 0.24
169 0.23
170 0.26
171 0.26
172 0.28
173 0.29
174 0.3
175 0.24
176 0.23
177 0.26
178 0.29
179 0.3
180 0.29
181 0.29
182 0.29
183 0.27
184 0.27
185 0.23
186 0.18
187 0.17
188 0.17
189 0.16
190 0.13
191 0.12
192 0.09
193 0.08
194 0.07
195 0.07
196 0.09
197 0.07
198 0.07
199 0.08
200 0.1
201 0.1
202 0.1
203 0.12
204 0.13
205 0.12
206 0.12
207 0.12
208 0.12
209 0.13
210 0.15
211 0.18
212 0.24
213 0.32
214 0.37
215 0.42
216 0.44
217 0.46
218 0.46
219 0.45
220 0.39
221 0.33
222 0.34
223 0.3
224 0.27
225 0.23
226 0.2
227 0.15
228 0.14
229 0.11
230 0.04
231 0.04
232 0.04
233 0.03
234 0.04
235 0.07
236 0.08
237 0.13
238 0.21
239 0.24
240 0.27
241 0.36
242 0.42
243 0.5
244 0.6
245 0.67
246 0.7
247 0.79
248 0.86
249 0.89
250 0.94