Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BTM2

Protein Details
Accession H6BTM2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
110-143CKKGMEGLRKRDKKKAKEKAKAKKKGGKNTTTTTBasic
NLS Segment(s)
PositionSequence
115-137EGLRKRDKKKAKEKAKAKKKGGK
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MSQQQQRISNDEFLSRLTTLLSSTHAESHGSVYLTQKPLITNSTTTEAAESLSSQTPQILIRATNGLSKSHRKATSSSKSNEKGSPKIKFATVVDVADLDAFYARYAEACKKGMEGLRKRDKKKAKEKAKAKKKGGKNTTTTTTTAAAAAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.2
4 0.14
5 0.13
6 0.12
7 0.12
8 0.14
9 0.12
10 0.13
11 0.15
12 0.15
13 0.16
14 0.15
15 0.17
16 0.17
17 0.15
18 0.15
19 0.16
20 0.21
21 0.22
22 0.23
23 0.21
24 0.2
25 0.21
26 0.22
27 0.22
28 0.17
29 0.18
30 0.21
31 0.2
32 0.19
33 0.18
34 0.15
35 0.14
36 0.12
37 0.1
38 0.08
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.1
46 0.08
47 0.08
48 0.09
49 0.1
50 0.11
51 0.13
52 0.13
53 0.14
54 0.17
55 0.22
56 0.24
57 0.3
58 0.31
59 0.3
60 0.32
61 0.4
62 0.46
63 0.47
64 0.47
65 0.47
66 0.49
67 0.5
68 0.51
69 0.46
70 0.44
71 0.44
72 0.45
73 0.4
74 0.38
75 0.35
76 0.33
77 0.3
78 0.28
79 0.23
80 0.19
81 0.16
82 0.15
83 0.15
84 0.12
85 0.11
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.07
94 0.11
95 0.14
96 0.16
97 0.16
98 0.17
99 0.2
100 0.24
101 0.32
102 0.36
103 0.43
104 0.52
105 0.61
106 0.64
107 0.71
108 0.77
109 0.77
110 0.81
111 0.81
112 0.82
113 0.83
114 0.9
115 0.91
116 0.93
117 0.92
118 0.91
119 0.9
120 0.89
121 0.89
122 0.88
123 0.86
124 0.82
125 0.79
126 0.75
127 0.69
128 0.61
129 0.53
130 0.44
131 0.36
132 0.29