Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BN70

Protein Details
Accession H6BN70    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-73QGMSIPFRPRRRPRRILRDNIKGIHydrophilic
NLS Segment(s)
PositionSequence
57-84RPRRRPRRILRDNIKGITKPTIRRLARR
Subcellular Location(s) cyto 13.5, cyto_nucl 12.833, nucl 10, cyto_pero 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MRDCPNLSLSDRRHSNKMAEETPIIVPDSGAGEAGAGAGGTAGAGIAIGQGMSIPFRPRRRPRRILRDNIKGITKPTIRRLARRGGIGDMEDEVYDTVRDVVKARVTEVSVPSRLLPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.52
4 0.55
5 0.48
6 0.43
7 0.4
8 0.37
9 0.35
10 0.31
11 0.23
12 0.16
13 0.14
14 0.11
15 0.11
16 0.09
17 0.08
18 0.06
19 0.05
20 0.05
21 0.05
22 0.04
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.01
30 0.01
31 0.01
32 0.01
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.04
41 0.07
42 0.13
43 0.18
44 0.28
45 0.38
46 0.49
47 0.58
48 0.67
49 0.75
50 0.8
51 0.85
52 0.87
53 0.85
54 0.84
55 0.79
56 0.72
57 0.64
58 0.54
59 0.46
60 0.43
61 0.38
62 0.33
63 0.35
64 0.42
65 0.42
66 0.47
67 0.51
68 0.52
69 0.51
70 0.51
71 0.46
72 0.38
73 0.37
74 0.31
75 0.27
76 0.19
77 0.16
78 0.12
79 0.11
80 0.08
81 0.07
82 0.07
83 0.06
84 0.07
85 0.07
86 0.08
87 0.1
88 0.14
89 0.18
90 0.19
91 0.2
92 0.22
93 0.23
94 0.27
95 0.3
96 0.32
97 0.29
98 0.29