Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6C0Q4

Protein Details
Accession H6C0Q4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
128-151KDSQRVKKDVPEKKPRGLKGHKTEBasic
NLS Segment(s)
PositionSequence
133-149VKKDVPEKKPRGLKGHK
Subcellular Location(s) nucl 13, cyto_nucl 11, mito 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSERSNISGDLIWEVVRNNNSFLVKRSSAGGVQFSRDPFNLVNKHSRKHEGFVNDKAVSVQANEKGGVTLKTKKPGKANKPASQHNVHAYGKTVSNRKLYKNIADAVGKNSYRADLNRDAIARASAIKDSQRVKKDVPEKKPRGLKGHKTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.18
4 0.19
5 0.19
6 0.22
7 0.25
8 0.25
9 0.28
10 0.3
11 0.28
12 0.27
13 0.28
14 0.26
15 0.25
16 0.25
17 0.28
18 0.21
19 0.23
20 0.25
21 0.24
22 0.24
23 0.22
24 0.23
25 0.19
26 0.26
27 0.27
28 0.28
29 0.37
30 0.38
31 0.42
32 0.44
33 0.5
34 0.45
35 0.43
36 0.45
37 0.43
38 0.44
39 0.45
40 0.46
41 0.39
42 0.36
43 0.34
44 0.28
45 0.21
46 0.17
47 0.15
48 0.11
49 0.11
50 0.12
51 0.11
52 0.11
53 0.12
54 0.13
55 0.13
56 0.18
57 0.2
58 0.29
59 0.32
60 0.35
61 0.43
62 0.5
63 0.55
64 0.59
65 0.65
66 0.64
67 0.67
68 0.69
69 0.66
70 0.6
71 0.54
72 0.46
73 0.44
74 0.37
75 0.31
76 0.27
77 0.23
78 0.23
79 0.24
80 0.26
81 0.23
82 0.31
83 0.34
84 0.35
85 0.41
86 0.41
87 0.42
88 0.41
89 0.39
90 0.35
91 0.34
92 0.32
93 0.29
94 0.32
95 0.27
96 0.24
97 0.22
98 0.2
99 0.2
100 0.2
101 0.23
102 0.22
103 0.25
104 0.28
105 0.28
106 0.27
107 0.25
108 0.25
109 0.19
110 0.15
111 0.14
112 0.12
113 0.13
114 0.15
115 0.2
116 0.26
117 0.34
118 0.39
119 0.42
120 0.43
121 0.5
122 0.58
123 0.61
124 0.66
125 0.69
126 0.69
127 0.75
128 0.81
129 0.79
130 0.79
131 0.8
132 0.8