Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6C1Y6

Protein Details
Accession H6C1Y6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
149-172KFPLPHRSSKSKKLFTPNRPSTFAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 11.666, cyto_nucl 11.333, mito 5.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028877  50S_L18Ae/Ribosomal_L18a/L20  
IPR023573  Ribosomal_L18a//L18Ae/LX  
IPR021138  Ribosomal_L18a/L20_eukaryotes  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01775  Ribosomal_L18A  
Amino Acid Sequences MGRLQEYQVIGRHLPTDSNPTPKLYRMRIFAPNTVVAKSRFWYFLMKLRKVKKSNGEVVAINVIHEKRPLKVKNFGIWIRYDSRSGTHNMYKEYREMSRTEAVEALYQDMAARHRARFRSIHILKVVELTKPDDVKRPYIKQLISKGLKFPLPHRSSKSKKLFTPNRPSTFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.26
4 0.27
5 0.34
6 0.34
7 0.37
8 0.38
9 0.42
10 0.47
11 0.46
12 0.47
13 0.44
14 0.48
15 0.52
16 0.53
17 0.51
18 0.47
19 0.45
20 0.41
21 0.38
22 0.36
23 0.29
24 0.27
25 0.25
26 0.24
27 0.2
28 0.2
29 0.23
30 0.22
31 0.29
32 0.36
33 0.41
34 0.46
35 0.53
36 0.61
37 0.6
38 0.65
39 0.66
40 0.65
41 0.66
42 0.62
43 0.56
44 0.47
45 0.44
46 0.4
47 0.3
48 0.23
49 0.17
50 0.14
51 0.12
52 0.15
53 0.14
54 0.13
55 0.23
56 0.27
57 0.29
58 0.37
59 0.4
60 0.42
61 0.47
62 0.46
63 0.39
64 0.36
65 0.34
66 0.3
67 0.28
68 0.24
69 0.18
70 0.17
71 0.17
72 0.19
73 0.2
74 0.19
75 0.2
76 0.22
77 0.24
78 0.23
79 0.23
80 0.23
81 0.21
82 0.19
83 0.19
84 0.2
85 0.22
86 0.21
87 0.2
88 0.19
89 0.18
90 0.17
91 0.16
92 0.14
93 0.09
94 0.09
95 0.08
96 0.08
97 0.09
98 0.12
99 0.14
100 0.15
101 0.21
102 0.23
103 0.27
104 0.29
105 0.33
106 0.39
107 0.39
108 0.42
109 0.39
110 0.38
111 0.35
112 0.37
113 0.33
114 0.23
115 0.22
116 0.2
117 0.21
118 0.23
119 0.24
120 0.27
121 0.29
122 0.36
123 0.42
124 0.44
125 0.47
126 0.51
127 0.53
128 0.53
129 0.57
130 0.59
131 0.57
132 0.54
133 0.51
134 0.48
135 0.48
136 0.43
137 0.41
138 0.42
139 0.41
140 0.46
141 0.5
142 0.56
143 0.61
144 0.69
145 0.75
146 0.72
147 0.75
148 0.79
149 0.83
150 0.82
151 0.86
152 0.86