Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6C450

Protein Details
Accession H6C450    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MWERLCALFRRHRRPHTSKQRRQSDPLGNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MWERLCALFRRHRRPHTSKQRRQSDPLGNLSEVSAPPPIENRHDSGLYRHHTLEENLRRNSRGEDVDGDDEENEDILVRHHTLEENLELARELTQEMRRQSHELRRLSTDREHATSSKEAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.88
4 0.89
5 0.88
6 0.89
7 0.9
8 0.86
9 0.83
10 0.81
11 0.79
12 0.74
13 0.71
14 0.64
15 0.54
16 0.47
17 0.41
18 0.34
19 0.24
20 0.19
21 0.14
22 0.1
23 0.1
24 0.14
25 0.15
26 0.18
27 0.2
28 0.21
29 0.22
30 0.23
31 0.24
32 0.23
33 0.28
34 0.27
35 0.27
36 0.25
37 0.23
38 0.23
39 0.24
40 0.3
41 0.32
42 0.36
43 0.36
44 0.37
45 0.37
46 0.36
47 0.37
48 0.3
49 0.23
50 0.18
51 0.17
52 0.18
53 0.19
54 0.18
55 0.16
56 0.13
57 0.12
58 0.1
59 0.08
60 0.05
61 0.04
62 0.04
63 0.04
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.09
70 0.11
71 0.11
72 0.1
73 0.1
74 0.1
75 0.09
76 0.09
77 0.09
78 0.07
79 0.07
80 0.1
81 0.15
82 0.2
83 0.24
84 0.28
85 0.3
86 0.35
87 0.42
88 0.47
89 0.51
90 0.51
91 0.51
92 0.55
93 0.55
94 0.55
95 0.54
96 0.53
97 0.49
98 0.47
99 0.47
100 0.41
101 0.43