Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6BUX3

Protein Details
Accession H6BUX3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-72STCWIKKRTRSKSTHFKTKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 8, extr 7
Family & Domain DBs
Amino Acid Sequences MATTKPTLAASVTNPGSVLCDIVKVLSALVLGRIKRLPKSIPPLRMASSSPGSTCWIKKRTRSKSTHFKTKSNPLRNLEKKFFWVPTSYSWPTTSTGIPWMWDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.2
4 0.17
5 0.16
6 0.09
7 0.09
8 0.08
9 0.09
10 0.09
11 0.07
12 0.07
13 0.06
14 0.06
15 0.05
16 0.08
17 0.11
18 0.11
19 0.13
20 0.16
21 0.18
22 0.2
23 0.23
24 0.23
25 0.27
26 0.37
27 0.41
28 0.44
29 0.45
30 0.46
31 0.44
32 0.42
33 0.37
34 0.31
35 0.26
36 0.21
37 0.18
38 0.16
39 0.17
40 0.17
41 0.18
42 0.22
43 0.26
44 0.29
45 0.38
46 0.47
47 0.55
48 0.63
49 0.68
50 0.7
51 0.74
52 0.79
53 0.81
54 0.75
55 0.71
56 0.68
57 0.72
58 0.74
59 0.72
60 0.72
61 0.66
62 0.73
63 0.75
64 0.76
65 0.71
66 0.62
67 0.58
68 0.55
69 0.52
70 0.43
71 0.38
72 0.32
73 0.32
74 0.39
75 0.36
76 0.35
77 0.34
78 0.33
79 0.33
80 0.33
81 0.28
82 0.21
83 0.23
84 0.21