Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BR72

Protein Details
Accession H6BR72    Localization Confidence High Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
106-130MAEKMHKKLVERRKRREKRNKLLKSBasic
NLS Segment(s)
PositionSequence
42-45PKKP
69-71KAK
75-130MKAEKEEQRNQRIQAIRERRKAKEEKERYEKMAEKMHKKLVERRKRREKRNKLLKS
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSAASPTPQSSTATSATAATADKQKTAQKPGMRVNGKNWHAPKKPFRPTAGQTSYAKRKEQDAIKQAIKAKEQEMKAEKEEQRNQRIQAIRERRKAKEEKERYEKMAEKMHKKLVERRKRREKRNKLLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.15
5 0.14
6 0.12
7 0.17
8 0.17
9 0.18
10 0.21
11 0.27
12 0.32
13 0.38
14 0.43
15 0.41
16 0.47
17 0.54
18 0.61
19 0.59
20 0.56
21 0.57
22 0.6
23 0.57
24 0.58
25 0.55
26 0.54
27 0.55
28 0.61
29 0.63
30 0.63
31 0.7
32 0.68
33 0.66
34 0.64
35 0.62
36 0.64
37 0.59
38 0.53
39 0.47
40 0.48
41 0.53
42 0.48
43 0.46
44 0.37
45 0.35
46 0.37
47 0.4
48 0.41
49 0.38
50 0.41
51 0.4
52 0.43
53 0.44
54 0.4
55 0.36
56 0.3
57 0.26
58 0.27
59 0.26
60 0.29
61 0.29
62 0.29
63 0.3
64 0.36
65 0.37
66 0.4
67 0.48
68 0.49
69 0.52
70 0.53
71 0.53
72 0.52
73 0.52
74 0.47
75 0.49
76 0.53
77 0.55
78 0.6
79 0.64
80 0.61
81 0.65
82 0.7
83 0.68
84 0.69
85 0.7
86 0.71
87 0.74
88 0.76
89 0.71
90 0.7
91 0.67
92 0.61
93 0.6
94 0.58
95 0.56
96 0.57
97 0.62
98 0.59
99 0.58
100 0.63
101 0.64
102 0.68
103 0.71
104 0.76
105 0.8
106 0.85
107 0.92
108 0.94
109 0.94
110 0.94