Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6C7A4

Protein Details
Accession H6C7A4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
31-52AQTTRRDWTVRRIPRRQHSTASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
IPR010233  UbiG_MeTrfase  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0008425  F:2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity  
GO:0008689  F:3-demethylubiquinone-9 3-O-methyltransferase activity  
GO:0004395  F:hexaprenyldihydroxybenzoate methyltransferase activity  
GO:0032259  P:methylation  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MAPGSQCRNALRAITKSPSLTTRSSSHRVTAQTTRRDWTVRRIPRRQHSTASASPTSPSASSVSASEVSHFSRLASSWWDPHGPSRLLHLMNPLRHDFIRLCMDSSFSAAETTSTSTPRSYSYLDIGCGGGIFASSAARLPSTSTVTAIDPTELVIQVAKSHQRSDPAIAAPKLRYLNCAIEDLPVPATDEQKVDVLTVFEVLEHIDSPSSFLELAIPHVKPGGWIIGSTISRSLTAFLTTKLIAEAPLIGVVPPGTHDWNKYINPSELRQYFETRASGSWGKFKTQGVVYVPALGWRFVNNSEEFGNYFFGVQKLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.41
4 0.42
5 0.41
6 0.39
7 0.36
8 0.35
9 0.36
10 0.4
11 0.44
12 0.44
13 0.43
14 0.44
15 0.44
16 0.46
17 0.5
18 0.51
19 0.53
20 0.54
21 0.54
22 0.52
23 0.54
24 0.51
25 0.51
26 0.53
27 0.55
28 0.62
29 0.69
30 0.75
31 0.8
32 0.86
33 0.81
34 0.77
35 0.73
36 0.71
37 0.67
38 0.64
39 0.56
40 0.47
41 0.43
42 0.37
43 0.32
44 0.24
45 0.2
46 0.15
47 0.13
48 0.14
49 0.13
50 0.15
51 0.15
52 0.15
53 0.15
54 0.15
55 0.16
56 0.16
57 0.16
58 0.13
59 0.12
60 0.13
61 0.13
62 0.16
63 0.16
64 0.18
65 0.2
66 0.22
67 0.21
68 0.25
69 0.3
70 0.26
71 0.25
72 0.27
73 0.3
74 0.29
75 0.3
76 0.34
77 0.33
78 0.34
79 0.38
80 0.34
81 0.31
82 0.3
83 0.32
84 0.24
85 0.23
86 0.27
87 0.24
88 0.23
89 0.21
90 0.22
91 0.2
92 0.2
93 0.16
94 0.1
95 0.09
96 0.08
97 0.08
98 0.07
99 0.1
100 0.1
101 0.1
102 0.11
103 0.11
104 0.12
105 0.13
106 0.15
107 0.15
108 0.15
109 0.18
110 0.18
111 0.18
112 0.18
113 0.16
114 0.13
115 0.11
116 0.09
117 0.05
118 0.04
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.04
126 0.04
127 0.05
128 0.07
129 0.1
130 0.1
131 0.1
132 0.11
133 0.11
134 0.12
135 0.12
136 0.1
137 0.07
138 0.07
139 0.07
140 0.06
141 0.06
142 0.05
143 0.05
144 0.05
145 0.07
146 0.1
147 0.1
148 0.12
149 0.13
150 0.16
151 0.17
152 0.19
153 0.21
154 0.19
155 0.23
156 0.22
157 0.23
158 0.2
159 0.23
160 0.23
161 0.2
162 0.2
163 0.18
164 0.21
165 0.2
166 0.21
167 0.18
168 0.16
169 0.16
170 0.15
171 0.13
172 0.1
173 0.1
174 0.09
175 0.1
176 0.1
177 0.1
178 0.1
179 0.1
180 0.1
181 0.09
182 0.08
183 0.08
184 0.07
185 0.07
186 0.06
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.06
196 0.06
197 0.07
198 0.07
199 0.06
200 0.08
201 0.07
202 0.11
203 0.14
204 0.14
205 0.13
206 0.14
207 0.14
208 0.12
209 0.13
210 0.12
211 0.09
212 0.09
213 0.1
214 0.15
215 0.15
216 0.15
217 0.16
218 0.13
219 0.13
220 0.14
221 0.14
222 0.09
223 0.12
224 0.12
225 0.12
226 0.14
227 0.13
228 0.14
229 0.13
230 0.12
231 0.1
232 0.09
233 0.09
234 0.06
235 0.07
236 0.07
237 0.06
238 0.06
239 0.06
240 0.05
241 0.06
242 0.08
243 0.12
244 0.13
245 0.15
246 0.19
247 0.25
248 0.27
249 0.3
250 0.32
251 0.34
252 0.37
253 0.38
254 0.43
255 0.4
256 0.43
257 0.41
258 0.42
259 0.39
260 0.39
261 0.38
262 0.31
263 0.28
264 0.3
265 0.32
266 0.28
267 0.33
268 0.31
269 0.33
270 0.35
271 0.36
272 0.36
273 0.33
274 0.37
275 0.33
276 0.37
277 0.34
278 0.33
279 0.32
280 0.3
281 0.29
282 0.24
283 0.2
284 0.16
285 0.19
286 0.18
287 0.23
288 0.19
289 0.21
290 0.22
291 0.23
292 0.22
293 0.21
294 0.21
295 0.17
296 0.16
297 0.15