Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6C2V3

Protein Details
Accession H6C2V3   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MPPKKVAKRKAPAKKGDRPPKRRATGRHPLDHDBasic
NLS Segment(s)
PositionSequence
3-27PKKVAKRKAPAKKGDRPPKRRATGR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MPPKKVAKRKAPAKKGDRPPKRRATGRHPLDHDPIEIIQPSCAINNSMRIPWEPPEWLTVPPPPVPGSKGNEDDDADVEFILPSAPELPAQRQRRKIVDHPNSGHESNTGFAEAIANHTLLNTTSDDLNLPEVLTLEDLELGRSLLFFDIEDFLGKVVNDVDEEEKDGFERQDDFIRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.9
4 0.9
5 0.88
6 0.88
7 0.88
8 0.88
9 0.86
10 0.84
11 0.82
12 0.82
13 0.82
14 0.81
15 0.75
16 0.71
17 0.69
18 0.62
19 0.53
20 0.44
21 0.35
22 0.28
23 0.25
24 0.2
25 0.14
26 0.13
27 0.13
28 0.11
29 0.11
30 0.11
31 0.1
32 0.15
33 0.17
34 0.17
35 0.18
36 0.19
37 0.2
38 0.21
39 0.23
40 0.19
41 0.18
42 0.2
43 0.21
44 0.2
45 0.2
46 0.2
47 0.2
48 0.2
49 0.21
50 0.18
51 0.18
52 0.2
53 0.23
54 0.24
55 0.26
56 0.28
57 0.28
58 0.28
59 0.28
60 0.25
61 0.21
62 0.18
63 0.13
64 0.09
65 0.08
66 0.06
67 0.05
68 0.04
69 0.03
70 0.03
71 0.03
72 0.04
73 0.05
74 0.06
75 0.1
76 0.19
77 0.27
78 0.33
79 0.38
80 0.42
81 0.46
82 0.5
83 0.54
84 0.57
85 0.58
86 0.6
87 0.56
88 0.56
89 0.56
90 0.51
91 0.43
92 0.33
93 0.24
94 0.17
95 0.15
96 0.11
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.08
107 0.07
108 0.09
109 0.07
110 0.08
111 0.08
112 0.08
113 0.09
114 0.09
115 0.1
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.05
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.07
132 0.06
133 0.06
134 0.05
135 0.07
136 0.08
137 0.09
138 0.1
139 0.09
140 0.09
141 0.1
142 0.1
143 0.09
144 0.08
145 0.08
146 0.08
147 0.1
148 0.13
149 0.12
150 0.15
151 0.15
152 0.14
153 0.15
154 0.17
155 0.15
156 0.15
157 0.16
158 0.16