Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6C0F6

Protein Details
Accession H6C0F6   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24RVGIRQSHPRARPRRTWPSTHydrophilic
NLS Segment(s)
PositionSequence
36-50KPAKAERARPRAVGR
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MGALRVGIRQSHPRARPRRTWPSTSSHSSSLMGSPKPAKAERARPRAVGRKLSVFEPLVPGVAPLDLPVPRSRGEPDSATMRRPEAGVVEADEAPKVGVAPMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.76
4 0.77
5 0.81
6 0.78
7 0.78
8 0.72
9 0.7
10 0.69
11 0.66
12 0.6
13 0.5
14 0.45
15 0.39
16 0.35
17 0.31
18 0.28
19 0.22
20 0.2
21 0.21
22 0.2
23 0.24
24 0.24
25 0.26
26 0.28
27 0.39
28 0.46
29 0.52
30 0.52
31 0.52
32 0.57
33 0.6
34 0.59
35 0.54
36 0.46
37 0.42
38 0.41
39 0.38
40 0.35
41 0.26
42 0.22
43 0.18
44 0.16
45 0.12
46 0.1
47 0.1
48 0.07
49 0.06
50 0.06
51 0.04
52 0.06
53 0.06
54 0.08
55 0.1
56 0.11
57 0.12
58 0.14
59 0.17
60 0.18
61 0.21
62 0.21
63 0.22
64 0.3
65 0.3
66 0.31
67 0.3
68 0.28
69 0.26
70 0.24
71 0.22
72 0.15
73 0.15
74 0.14
75 0.14
76 0.16
77 0.15
78 0.15
79 0.14
80 0.13
81 0.11
82 0.1
83 0.08