Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BWE5

Protein Details
Accession H6BWE5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
105-128LWQCSARKKVCKVPKFKAKRRSANHydrophilic
NLS Segment(s)
PositionSequence
116-126KVPKFKAKRRS
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MASTTTTHDNARTKRMLMGSLRPGQSIGSPYIYHARLSTIAPSSHFQLFNLCASTTIPSFPTAQPHEAAWPNPQSVWYVSKAWTLERAARTAGVPWTGVPVRVLLWQCSARKKVCKVPKFKAKRRSAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.41
4 0.37
5 0.41
6 0.41
7 0.45
8 0.45
9 0.4
10 0.38
11 0.33
12 0.31
13 0.26
14 0.2
15 0.16
16 0.15
17 0.17
18 0.22
19 0.22
20 0.21
21 0.18
22 0.18
23 0.17
24 0.17
25 0.18
26 0.15
27 0.15
28 0.17
29 0.18
30 0.19
31 0.21
32 0.21
33 0.18
34 0.17
35 0.18
36 0.17
37 0.17
38 0.14
39 0.11
40 0.11
41 0.13
42 0.1
43 0.09
44 0.09
45 0.09
46 0.11
47 0.11
48 0.16
49 0.17
50 0.17
51 0.17
52 0.17
53 0.19
54 0.18
55 0.19
56 0.17
57 0.16
58 0.16
59 0.15
60 0.15
61 0.13
62 0.14
63 0.15
64 0.15
65 0.15
66 0.15
67 0.18
68 0.18
69 0.17
70 0.19
71 0.19
72 0.22
73 0.22
74 0.22
75 0.2
76 0.2
77 0.2
78 0.18
79 0.18
80 0.13
81 0.12
82 0.11
83 0.15
84 0.15
85 0.15
86 0.13
87 0.12
88 0.12
89 0.17
90 0.19
91 0.15
92 0.2
93 0.25
94 0.29
95 0.36
96 0.41
97 0.43
98 0.49
99 0.54
100 0.6
101 0.65
102 0.7
103 0.73
104 0.77
105 0.81
106 0.84
107 0.88
108 0.88