Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6BK47

Protein Details
Accession H6BK47    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-22VLEVKPKTKKFKAQNIPGVPDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, cyto_nucl 13, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014710  RmlC-like_jellyroll  
Amino Acid Sequences MVLEVKPKTKKFKAQNIPGVPDHVYFTDFLGSRDESVPNPITGSWFRIERGPPSTPPKYEYDEVGVVIEGNLPGELLDFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.8
4 0.78
5 0.69
6 0.62
7 0.52
8 0.42
9 0.33
10 0.24
11 0.18
12 0.13
13 0.13
14 0.14
15 0.13
16 0.12
17 0.14
18 0.13
19 0.14
20 0.15
21 0.15
22 0.12
23 0.15
24 0.16
25 0.13
26 0.13
27 0.11
28 0.13
29 0.12
30 0.14
31 0.12
32 0.12
33 0.12
34 0.15
35 0.17
36 0.18
37 0.22
38 0.23
39 0.26
40 0.33
41 0.37
42 0.36
43 0.38
44 0.38
45 0.39
46 0.38
47 0.35
48 0.32
49 0.28
50 0.27
51 0.24
52 0.2
53 0.14
54 0.13
55 0.12
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05