Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UE18

Protein Details
Accession Q0UE18   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
126-153GMVPRNDFKKRMKKVRKAGEARKLPGEKBasic
NLS Segment(s)
PositionSequence
133-153FKKRMKKVRKAGEARKLPGEK
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
KEGG pno:SNOG_09996  -  
Amino Acid Sequences MPAPKLRTRESPKYIVATAQSSKYAFAKPSTPTSIPPPCTICTRLSTIFPCCLTLKSSSPCPTCLAFDAAFAAKAPDAETTRQIQQDRVESLKLTTKDLEAEKDYLKTGLEEKRKIMQQKVKQLDGMVPRNDFKKRMKKVRKAGEARKLPGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.5
3 0.44
4 0.39
5 0.35
6 0.3
7 0.29
8 0.24
9 0.25
10 0.25
11 0.25
12 0.21
13 0.21
14 0.23
15 0.24
16 0.3
17 0.34
18 0.33
19 0.33
20 0.39
21 0.44
22 0.42
23 0.42
24 0.4
25 0.35
26 0.38
27 0.39
28 0.33
29 0.28
30 0.3
31 0.28
32 0.28
33 0.29
34 0.28
35 0.28
36 0.26
37 0.26
38 0.22
39 0.21
40 0.2
41 0.2
42 0.22
43 0.22
44 0.27
45 0.31
46 0.31
47 0.32
48 0.32
49 0.3
50 0.26
51 0.25
52 0.22
53 0.16
54 0.15
55 0.15
56 0.12
57 0.11
58 0.1
59 0.09
60 0.05
61 0.05
62 0.06
63 0.06
64 0.08
65 0.09
66 0.11
67 0.13
68 0.16
69 0.19
70 0.19
71 0.2
72 0.21
73 0.23
74 0.24
75 0.23
76 0.21
77 0.18
78 0.18
79 0.22
80 0.21
81 0.19
82 0.17
83 0.16
84 0.19
85 0.2
86 0.21
87 0.17
88 0.19
89 0.18
90 0.18
91 0.18
92 0.16
93 0.15
94 0.13
95 0.15
96 0.21
97 0.27
98 0.28
99 0.3
100 0.37
101 0.42
102 0.46
103 0.5
104 0.52
105 0.53
106 0.62
107 0.66
108 0.61
109 0.57
110 0.53
111 0.5
112 0.49
113 0.48
114 0.4
115 0.37
116 0.37
117 0.41
118 0.44
119 0.43
120 0.45
121 0.48
122 0.56
123 0.64
124 0.73
125 0.79
126 0.86
127 0.91
128 0.92
129 0.91
130 0.91
131 0.9
132 0.88
133 0.82