Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6BKR7

Protein Details
Accession H6BKR7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIIKKHPKKWHRHQSDTFKCVPSAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-19PIIKKHPKKWH
35-37KPK
42-45RVRR
Subcellular Location(s) mito 17.5, mito_nucl 12, nucl 5.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIIKKHPKKWHRHQSDTFKCVPSAWRKPKGIDNRVRRRFKGQMVMPSIGYGSNKKTRHMMPSGHKAFLVHNPKDVELLLMHNRTYAAEIASAVSSRKRVEIVAKAKALGVKVTNGKAKITTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.88
4 0.9
5 0.9
6 0.89
7 0.89
8 0.9
9 0.91
10 0.91
11 0.86
12 0.79
13 0.7
14 0.6
15 0.51
16 0.48
17 0.46
18 0.47
19 0.51
20 0.55
21 0.55
22 0.58
23 0.66
24 0.69
25 0.7
26 0.68
27 0.7
28 0.72
29 0.8
30 0.83
31 0.76
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.37
42 0.32
43 0.23
44 0.2
45 0.13
46 0.13
47 0.19
48 0.2
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.32
62 0.35
63 0.36
64 0.26
65 0.28
66 0.29
67 0.29
68 0.29
69 0.27
70 0.2
71 0.12
72 0.15
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.14
79 0.15
80 0.12
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.13
92 0.13
93 0.14
94 0.2
95 0.29
96 0.34
97 0.39
98 0.4
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.21
106 0.25
107 0.3
108 0.35
109 0.34
110 0.35
111 0.34