Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BKX0

Protein Details
Accession H6BKX0   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
264-283DKAHRTAHRRFKDRWVQRMKBasic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 14, nucl 8
Family & Domain DBs
Amino Acid Sequences MSFLQTTFKTGYITDLILPPPPEGKTPTDVFRAGHSLALEMARSPETMSKLNPFVYSVRVISADDPQAVDVDAVAARFGVEVSPSSSSPPSAPPSPSPPAPPSPSPPAPSSQSVGDFVQYEIKDKLPVAFGFSADMTYHSAIRTTQQGIEALTDPGSGVLLHGKWGIEVAQGPDERGSANADADAHARTGSFDATAAGIADPRAGSAGGATGTGSGSGADGGVGGTGSGGTGSGITGSGRLHLLETNTTSCSVLVAWYIKASMDKAHRTAHRRFKDRWVQRMKELGYPCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.22
5 0.23
6 0.2
7 0.21
8 0.21
9 0.22
10 0.23
11 0.26
12 0.28
13 0.31
14 0.33
15 0.35
16 0.35
17 0.33
18 0.32
19 0.33
20 0.28
21 0.26
22 0.22
23 0.18
24 0.18
25 0.18
26 0.14
27 0.1
28 0.12
29 0.1
30 0.1
31 0.11
32 0.14
33 0.16
34 0.19
35 0.21
36 0.24
37 0.26
38 0.27
39 0.26
40 0.25
41 0.23
42 0.23
43 0.23
44 0.19
45 0.17
46 0.16
47 0.17
48 0.16
49 0.19
50 0.17
51 0.15
52 0.15
53 0.14
54 0.13
55 0.13
56 0.11
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.05
66 0.04
67 0.04
68 0.05
69 0.07
70 0.09
71 0.09
72 0.11
73 0.12
74 0.13
75 0.13
76 0.16
77 0.19
78 0.2
79 0.22
80 0.23
81 0.29
82 0.32
83 0.32
84 0.33
85 0.32
86 0.34
87 0.36
88 0.36
89 0.35
90 0.39
91 0.4
92 0.39
93 0.37
94 0.35
95 0.34
96 0.34
97 0.3
98 0.24
99 0.22
100 0.21
101 0.2
102 0.17
103 0.14
104 0.12
105 0.16
106 0.14
107 0.15
108 0.14
109 0.15
110 0.15
111 0.14
112 0.15
113 0.12
114 0.12
115 0.13
116 0.13
117 0.12
118 0.12
119 0.12
120 0.12
121 0.09
122 0.1
123 0.08
124 0.08
125 0.08
126 0.07
127 0.08
128 0.07
129 0.09
130 0.1
131 0.1
132 0.1
133 0.11
134 0.11
135 0.11
136 0.12
137 0.12
138 0.1
139 0.08
140 0.07
141 0.06
142 0.06
143 0.06
144 0.04
145 0.03
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.05
155 0.06
156 0.07
157 0.1
158 0.1
159 0.11
160 0.11
161 0.11
162 0.1
163 0.1
164 0.11
165 0.07
166 0.07
167 0.08
168 0.08
169 0.08
170 0.09
171 0.09
172 0.07
173 0.07
174 0.06
175 0.07
176 0.07
177 0.07
178 0.06
179 0.05
180 0.06
181 0.06
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.04
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.04
203 0.04
204 0.04
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.02
214 0.03
215 0.02
216 0.02
217 0.03
218 0.03
219 0.03
220 0.03
221 0.04
222 0.04
223 0.05
224 0.05
225 0.07
226 0.07
227 0.08
228 0.08
229 0.1
230 0.12
231 0.14
232 0.16
233 0.17
234 0.18
235 0.18
236 0.18
237 0.16
238 0.15
239 0.12
240 0.1
241 0.11
242 0.11
243 0.11
244 0.11
245 0.12
246 0.12
247 0.13
248 0.14
249 0.17
250 0.23
251 0.28
252 0.31
253 0.38
254 0.45
255 0.5
256 0.59
257 0.64
258 0.67
259 0.68
260 0.69
261 0.73
262 0.76
263 0.79
264 0.8
265 0.8
266 0.75
267 0.75
268 0.8
269 0.72
270 0.68