Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6C944

Protein Details
Accession H6C944    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
144-165RDMEEKRKAKRKEMQEYVRRLDBasic
NLS Segment(s)
PositionSequence
149-154KRKAKR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 5.5, mito 3, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR021384  Mediator_Med21  
Gene Ontology GO:0016592  C:mediator complex  
Pfam View protein in Pfam  
PF11221  Med21  
Amino Acid Sequences MSSDILTQLQTCYDQLLTQFFSTISYLSQRHPLVAPEPDPNDPFTFPPSNAVTTHTQSQTQTPGASQTASHQPQIQPGPEDTDRAPYPLRPVPPQVFANAQRELAEDLVQKGQQIELLVSRLPGIGASEQQQAEEIRVLAEKVRDMEEKRKAKRKEMQEYVRRLDGVILGMSQSIEELEVNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.16
4 0.17
5 0.16
6 0.17
7 0.15
8 0.16
9 0.15
10 0.14
11 0.12
12 0.14
13 0.15
14 0.17
15 0.24
16 0.23
17 0.24
18 0.25
19 0.26
20 0.25
21 0.28
22 0.29
23 0.27
24 0.3
25 0.3
26 0.3
27 0.31
28 0.29
29 0.25
30 0.24
31 0.24
32 0.24
33 0.21
34 0.25
35 0.24
36 0.24
37 0.23
38 0.26
39 0.24
40 0.24
41 0.29
42 0.25
43 0.25
44 0.24
45 0.26
46 0.25
47 0.22
48 0.2
49 0.15
50 0.16
51 0.15
52 0.15
53 0.12
54 0.12
55 0.2
56 0.21
57 0.22
58 0.22
59 0.22
60 0.27
61 0.29
62 0.27
63 0.2
64 0.19
65 0.24
66 0.21
67 0.22
68 0.17
69 0.2
70 0.19
71 0.19
72 0.19
73 0.14
74 0.18
75 0.2
76 0.22
77 0.19
78 0.23
79 0.24
80 0.27
81 0.27
82 0.24
83 0.25
84 0.26
85 0.29
86 0.25
87 0.23
88 0.19
89 0.19
90 0.18
91 0.15
92 0.13
93 0.09
94 0.1
95 0.11
96 0.11
97 0.1
98 0.1
99 0.09
100 0.09
101 0.08
102 0.07
103 0.07
104 0.08
105 0.08
106 0.08
107 0.08
108 0.07
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.1
115 0.14
116 0.14
117 0.14
118 0.15
119 0.14
120 0.15
121 0.14
122 0.12
123 0.09
124 0.09
125 0.1
126 0.1
127 0.11
128 0.11
129 0.12
130 0.15
131 0.19
132 0.22
133 0.31
134 0.39
135 0.47
136 0.54
137 0.63
138 0.64
139 0.69
140 0.74
141 0.76
142 0.77
143 0.79
144 0.8
145 0.8
146 0.83
147 0.79
148 0.73
149 0.63
150 0.52
151 0.43
152 0.34
153 0.26
154 0.19
155 0.14
156 0.11
157 0.11
158 0.1
159 0.09
160 0.07
161 0.05
162 0.05