Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BY18

Protein Details
Accession H6BY18   
Localization Confidence High
Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
4-23KPPSNAKTTNKNLKARKSATHydrophilic
26-51SSAASKSKIGKRPPPKQVKTKPGVHSHydrophilic
137-180EIREARRREMEKKKEKKQAELEEVKKEIKKGKTKNNDKQPSDSTBasic
NLS Segment(s)
PositionSequence
16-46LKARKSATSGSSAASKSKIGKRPPPKQVKTK
94-100PRGKKKG
139-170REARRREMEKKKEKKQAELEEVKKEIKKGKTK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MAPKPPSNAKTTNKNLKARKSATSGSSAASKSKIGKRPPPKQVKTKPGVHSQTATGTSSSSAAKSSKRKQKTYTDKELNLPALNMITPVGVQKPRGKKKGKVFVDDKESMMTILAMVNAEKEGQIESKMIKARQLEEIREARRREMEKKKEKKQAELEEVKKEIKKGKTKNNDKQPSDSTTVDSGGSKNATKQKKRVSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.8
4 0.83
5 0.77
6 0.73
7 0.68
8 0.64
9 0.58
10 0.55
11 0.47
12 0.38
13 0.39
14 0.33
15 0.29
16 0.25
17 0.25
18 0.27
19 0.34
20 0.4
21 0.44
22 0.53
23 0.62
24 0.7
25 0.78
26 0.82
27 0.82
28 0.85
29 0.87
30 0.87
31 0.84
32 0.83
33 0.78
34 0.77
35 0.74
36 0.66
37 0.58
38 0.49
39 0.45
40 0.38
41 0.33
42 0.23
43 0.18
44 0.16
45 0.15
46 0.14
47 0.1
48 0.1
49 0.11
50 0.17
51 0.26
52 0.35
53 0.43
54 0.51
55 0.56
56 0.61
57 0.7
58 0.75
59 0.75
60 0.77
61 0.75
62 0.69
63 0.67
64 0.63
65 0.54
66 0.43
67 0.34
68 0.23
69 0.16
70 0.13
71 0.1
72 0.07
73 0.04
74 0.04
75 0.05
76 0.07
77 0.08
78 0.1
79 0.16
80 0.26
81 0.34
82 0.43
83 0.48
84 0.53
85 0.61
86 0.7
87 0.68
88 0.65
89 0.61
90 0.57
91 0.59
92 0.53
93 0.44
94 0.34
95 0.29
96 0.22
97 0.18
98 0.13
99 0.06
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.06
112 0.07
113 0.07
114 0.12
115 0.15
116 0.16
117 0.18
118 0.2
119 0.21
120 0.29
121 0.32
122 0.3
123 0.33
124 0.39
125 0.4
126 0.45
127 0.44
128 0.38
129 0.42
130 0.45
131 0.47
132 0.52
133 0.58
134 0.63
135 0.72
136 0.79
137 0.81
138 0.8
139 0.8
140 0.79
141 0.78
142 0.77
143 0.76
144 0.71
145 0.67
146 0.66
147 0.61
148 0.53
149 0.47
150 0.45
151 0.44
152 0.5
153 0.53
154 0.61
155 0.68
156 0.77
157 0.84
158 0.88
159 0.89
160 0.84
161 0.82
162 0.76
163 0.71
164 0.66
165 0.57
166 0.49
167 0.4
168 0.37
169 0.31
170 0.27
171 0.21
172 0.19
173 0.21
174 0.18
175 0.23
176 0.31
177 0.4
178 0.47
179 0.56
180 0.63