Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6C2P5

Protein Details
Accession H6C2P5   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
111-134NLHNNPKRRASRPNRIRTHRPIIPHydrophilic
136-160LRFPILRSPRRNRQNSIQHARPRPIHydrophilic
NLS Segment(s)
PositionSequence
117-134KRRASRPNRIRTHRPIIP
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MQTPHGNSIFLLLTPISTGSAEHPTPSRMYSMLVVAPSSNSREKEFLSHSRSSCCSCYCHINLPFPLYVSPSIRPYIRPPPSFHRSKHTLPTYLTNSIPWVFYSQHPQYPNLHNNPKRRASRPNRIRTHRPIIPILRFPILRSPRRNRQNSIQHARPRPIATST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.08
5 0.08
6 0.1
7 0.15
8 0.15
9 0.17
10 0.18
11 0.19
12 0.21
13 0.21
14 0.2
15 0.15
16 0.16
17 0.16
18 0.16
19 0.16
20 0.14
21 0.14
22 0.12
23 0.13
24 0.13
25 0.15
26 0.18
27 0.18
28 0.2
29 0.21
30 0.22
31 0.25
32 0.3
33 0.34
34 0.36
35 0.39
36 0.38
37 0.4
38 0.41
39 0.4
40 0.37
41 0.31
42 0.27
43 0.24
44 0.29
45 0.28
46 0.34
47 0.34
48 0.36
49 0.36
50 0.36
51 0.34
52 0.28
53 0.26
54 0.19
55 0.18
56 0.15
57 0.15
58 0.14
59 0.16
60 0.16
61 0.17
62 0.2
63 0.28
64 0.33
65 0.34
66 0.36
67 0.43
68 0.49
69 0.53
70 0.5
71 0.47
72 0.45
73 0.46
74 0.51
75 0.47
76 0.43
77 0.39
78 0.44
79 0.41
80 0.37
81 0.34
82 0.26
83 0.24
84 0.21
85 0.2
86 0.14
87 0.12
88 0.11
89 0.12
90 0.2
91 0.21
92 0.25
93 0.26
94 0.28
95 0.31
96 0.37
97 0.44
98 0.44
99 0.52
100 0.54
101 0.61
102 0.66
103 0.7
104 0.69
105 0.67
106 0.7
107 0.69
108 0.74
109 0.76
110 0.79
111 0.8
112 0.82
113 0.86
114 0.84
115 0.83
116 0.76
117 0.7
118 0.68
119 0.65
120 0.62
121 0.58
122 0.52
123 0.48
124 0.44
125 0.4
126 0.43
127 0.44
128 0.47
129 0.52
130 0.58
131 0.64
132 0.74
133 0.8
134 0.77
135 0.78
136 0.81
137 0.82
138 0.83
139 0.81
140 0.8
141 0.81
142 0.79
143 0.75
144 0.67