Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BVX8

Protein Details
Accession H6BVX8   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
218-237PYDRRDRWLAWRRRAARVKMHydrophilic
239-264LEAKAARATRKSKGKKSNKGAKMGAAHydrophilic
NLS Segment(s)
PositionSequence
209-266AERKGVKVRPYDRRDRWLAWRRRAARVKMGLEAKAARATRKSKGKKSNKGAKMGAAKR
Subcellular Location(s) mito 20, extr 4, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MLQPRLHRPLAPLDASLTSLLHSLTLCPKHAHPHPPSSTTFIRYASHAAQGRANGPTDSAGRRLGAKKTNSEYVVPGNIIFKQRGTKWHPGENVGIGKDHTIYATEHGYVRYYRDPLKHPKRRYIGVALAKEGPGSQLPTPPNAPSRRRLGMYATPIKETPSGKDFLESHLSSNSFVSFKTGAAPAPPPPTIMRDGTYREANVSIGRAAERKGVKVRPYDRRDRWLAWRRRAARVKMGLEAKAARATRKSKGKKSNKGAKMGAAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.29
4 0.2
5 0.13
6 0.12
7 0.11
8 0.09
9 0.09
10 0.1
11 0.17
12 0.2
13 0.22
14 0.24
15 0.26
16 0.34
17 0.41
18 0.48
19 0.46
20 0.53
21 0.56
22 0.58
23 0.58
24 0.56
25 0.53
26 0.47
27 0.44
28 0.36
29 0.32
30 0.3
31 0.32
32 0.27
33 0.31
34 0.3
35 0.29
36 0.29
37 0.29
38 0.29
39 0.27
40 0.26
41 0.19
42 0.16
43 0.17
44 0.18
45 0.18
46 0.18
47 0.17
48 0.16
49 0.21
50 0.25
51 0.29
52 0.33
53 0.35
54 0.39
55 0.43
56 0.48
57 0.45
58 0.42
59 0.38
60 0.34
61 0.32
62 0.25
63 0.21
64 0.17
65 0.17
66 0.18
67 0.17
68 0.15
69 0.18
70 0.2
71 0.27
72 0.33
73 0.4
74 0.42
75 0.49
76 0.49
77 0.47
78 0.47
79 0.42
80 0.38
81 0.29
82 0.25
83 0.18
84 0.17
85 0.15
86 0.13
87 0.09
88 0.07
89 0.07
90 0.09
91 0.1
92 0.1
93 0.1
94 0.1
95 0.12
96 0.11
97 0.13
98 0.14
99 0.16
100 0.19
101 0.22
102 0.28
103 0.37
104 0.48
105 0.54
106 0.56
107 0.63
108 0.64
109 0.63
110 0.61
111 0.55
112 0.52
113 0.49
114 0.46
115 0.38
116 0.34
117 0.31
118 0.27
119 0.21
120 0.14
121 0.08
122 0.09
123 0.08
124 0.12
125 0.12
126 0.14
127 0.16
128 0.17
129 0.23
130 0.27
131 0.3
132 0.3
133 0.35
134 0.36
135 0.36
136 0.36
137 0.34
138 0.33
139 0.38
140 0.41
141 0.36
142 0.34
143 0.33
144 0.34
145 0.32
146 0.28
147 0.23
148 0.18
149 0.19
150 0.18
151 0.21
152 0.2
153 0.19
154 0.25
155 0.22
156 0.21
157 0.22
158 0.22
159 0.19
160 0.2
161 0.18
162 0.11
163 0.11
164 0.13
165 0.11
166 0.1
167 0.12
168 0.12
169 0.11
170 0.13
171 0.14
172 0.15
173 0.18
174 0.18
175 0.18
176 0.18
177 0.21
178 0.23
179 0.23
180 0.21
181 0.21
182 0.25
183 0.27
184 0.28
185 0.25
186 0.23
187 0.22
188 0.21
189 0.19
190 0.16
191 0.12
192 0.11
193 0.12
194 0.12
195 0.12
196 0.18
197 0.19
198 0.22
199 0.28
200 0.33
201 0.37
202 0.45
203 0.53
204 0.57
205 0.63
206 0.7
207 0.69
208 0.72
209 0.73
210 0.69
211 0.71
212 0.71
213 0.73
214 0.72
215 0.76
216 0.73
217 0.77
218 0.81
219 0.76
220 0.75
221 0.74
222 0.67
223 0.64
224 0.63
225 0.54
226 0.49
227 0.45
228 0.37
229 0.35
230 0.33
231 0.3
232 0.33
233 0.37
234 0.42
235 0.51
236 0.59
237 0.63
238 0.73
239 0.8
240 0.84
241 0.9
242 0.92
243 0.88
244 0.87
245 0.8
246 0.77