Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BUL0

Protein Details
Accession H6BUL0   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-104EDETKTPPSKRARKPKRDPLDGELBasic
NLS Segment(s)
PositionSequence
75-97RKALKSEDETKTPPSKRARKPKR
Subcellular Location(s) nucl 13, mito 9, extr 2, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MRYTWTAERERRMLLLAISSADLKPSADTWATVAALLGEGLTPSAVSQKYYKLRNESAKLLDDQPGSVPSTPTKRKALKSEDETKTPPSKRARKPKRDPLDGELFSDAGSSPTEAKTNNVTPGATNTFQNYHEPFIPTDFFLPMNNQFKVGGSGSGSGSGSGNHSFPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.19
4 0.16
5 0.15
6 0.15
7 0.13
8 0.12
9 0.12
10 0.09
11 0.1
12 0.1
13 0.12
14 0.11
15 0.11
16 0.12
17 0.14
18 0.13
19 0.12
20 0.11
21 0.08
22 0.08
23 0.07
24 0.06
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.07
32 0.08
33 0.09
34 0.11
35 0.18
36 0.25
37 0.3
38 0.35
39 0.37
40 0.44
41 0.5
42 0.53
43 0.5
44 0.47
45 0.44
46 0.41
47 0.37
48 0.33
49 0.25
50 0.22
51 0.18
52 0.16
53 0.15
54 0.14
55 0.13
56 0.12
57 0.2
58 0.23
59 0.26
60 0.32
61 0.37
62 0.4
63 0.47
64 0.52
65 0.51
66 0.55
67 0.61
68 0.56
69 0.53
70 0.51
71 0.47
72 0.48
73 0.41
74 0.41
75 0.4
76 0.48
77 0.54
78 0.64
79 0.71
80 0.75
81 0.84
82 0.88
83 0.88
84 0.86
85 0.8
86 0.75
87 0.74
88 0.63
89 0.54
90 0.44
91 0.34
92 0.26
93 0.22
94 0.16
95 0.07
96 0.07
97 0.06
98 0.06
99 0.07
100 0.09
101 0.09
102 0.11
103 0.15
104 0.17
105 0.2
106 0.2
107 0.19
108 0.19
109 0.23
110 0.26
111 0.22
112 0.2
113 0.2
114 0.21
115 0.22
116 0.26
117 0.23
118 0.22
119 0.23
120 0.24
121 0.23
122 0.24
123 0.24
124 0.2
125 0.2
126 0.18
127 0.16
128 0.15
129 0.18
130 0.23
131 0.28
132 0.27
133 0.27
134 0.26
135 0.26
136 0.29
137 0.26
138 0.19
139 0.15
140 0.16
141 0.16
142 0.18
143 0.17
144 0.14
145 0.13
146 0.12
147 0.14
148 0.14