Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BV25

Protein Details
Accession H6BV25    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
190-209LAKRDRKDYVRKRQLKYTWFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, E.R. 4, extr 3, mito 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07264  EI24  
Amino Acid Sequences MVLNGWNAVWLYPLKGVIYLVLRPYFYPLFKARLIPILLLSAFIYANLFIWTFLPQVAFLAIFQGAGAWLNATFLVLGEGAAIVALLFEAFFVDETLVDIFDAVLIDQGLTDLVGQGRLLDLEAENSVQMLGKPTVSSIYSPFSLRQILEFVVLLPVNFIPFVGVPIFLLLTGYRAGPFHHWRYFTLRGLAKRDRKDYVRKRQLKYTWFGVVALTLQLVPVLSMFFLMTTAAGSALWAAKMEKARRVREQVAAPAAEPYQDNPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.14
5 0.16
6 0.17
7 0.19
8 0.2
9 0.2
10 0.2
11 0.25
12 0.26
13 0.23
14 0.27
15 0.26
16 0.29
17 0.31
18 0.34
19 0.3
20 0.33
21 0.33
22 0.28
23 0.25
24 0.23
25 0.21
26 0.19
27 0.17
28 0.12
29 0.1
30 0.09
31 0.09
32 0.06
33 0.07
34 0.07
35 0.07
36 0.06
37 0.07
38 0.08
39 0.08
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.06
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.03
103 0.03
104 0.04
105 0.04
106 0.04
107 0.03
108 0.03
109 0.04
110 0.04
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.08
124 0.08
125 0.08
126 0.09
127 0.1
128 0.11
129 0.12
130 0.12
131 0.13
132 0.12
133 0.12
134 0.11
135 0.1
136 0.1
137 0.09
138 0.08
139 0.08
140 0.08
141 0.07
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.04
148 0.04
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.07
164 0.13
165 0.19
166 0.24
167 0.28
168 0.3
169 0.31
170 0.38
171 0.43
172 0.39
173 0.4
174 0.39
175 0.39
176 0.45
177 0.52
178 0.53
179 0.54
180 0.56
181 0.55
182 0.57
183 0.64
184 0.68
185 0.7
186 0.73
187 0.76
188 0.76
189 0.79
190 0.8
191 0.76
192 0.71
193 0.64
194 0.58
195 0.49
196 0.45
197 0.35
198 0.28
199 0.22
200 0.17
201 0.12
202 0.06
203 0.06
204 0.05
205 0.05
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.04
216 0.04
217 0.05
218 0.05
219 0.04
220 0.04
221 0.06
222 0.06
223 0.06
224 0.07
225 0.08
226 0.12
227 0.19
228 0.23
229 0.3
230 0.38
231 0.45
232 0.53
233 0.61
234 0.61
235 0.61
236 0.63
237 0.63
238 0.6
239 0.54
240 0.45
241 0.4
242 0.35
243 0.29
244 0.24