Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6BTB6

Protein Details
Accession H6BTB6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-99AHPPNSLRGPRRRHLRRQAPNNNAQGQSHydrophilic
NLS Segment(s)
PositionSequence
67-88PKRERAHPPNSLRGPRRRHLRR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MPTWASGPHSGASRQSDLPGLKMGQPCSIIGTCCARYPWSCWTQISSLLTRKTNPRDSEVERAGDWPKRERAHPPNSLRGPRRRHLRRQAPNNNAQGQSIDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.3
4 0.27
5 0.28
6 0.26
7 0.22
8 0.23
9 0.26
10 0.26
11 0.23
12 0.24
13 0.22
14 0.23
15 0.22
16 0.18
17 0.16
18 0.2
19 0.18
20 0.18
21 0.19
22 0.17
23 0.17
24 0.2
25 0.25
26 0.24
27 0.25
28 0.24
29 0.26
30 0.26
31 0.28
32 0.27
33 0.23
34 0.24
35 0.25
36 0.26
37 0.25
38 0.29
39 0.32
40 0.37
41 0.35
42 0.35
43 0.38
44 0.41
45 0.47
46 0.43
47 0.38
48 0.31
49 0.32
50 0.3
51 0.28
52 0.27
53 0.24
54 0.29
55 0.3
56 0.32
57 0.39
58 0.46
59 0.51
60 0.58
61 0.59
62 0.62
63 0.68
64 0.74
65 0.72
66 0.72
67 0.71
68 0.69
69 0.75
70 0.74
71 0.78
72 0.8
73 0.83
74 0.85
75 0.89
76 0.92
77 0.9
78 0.89
79 0.86
80 0.81
81 0.71
82 0.61