Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BL45

Protein Details
Accession H6BL45    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-64SDRYTCTKPKPLTRPQLHKRPVVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, pero 3
Family & Domain DBs
Amino Acid Sequences MDPDRWAKDNALSEDIEGISLGSGYMVHNDPGASPNTGCNSDRYTCTKPKPLTRPQLHKRPVVSHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.2
4 0.12
5 0.09
6 0.05
7 0.05
8 0.05
9 0.03
10 0.03
11 0.03
12 0.06
13 0.06
14 0.06
15 0.07
16 0.07
17 0.07
18 0.09
19 0.1
20 0.08
21 0.08
22 0.1
23 0.12
24 0.14
25 0.14
26 0.15
27 0.18
28 0.19
29 0.22
30 0.27
31 0.31
32 0.37
33 0.42
34 0.49
35 0.51
36 0.59
37 0.65
38 0.69
39 0.74
40 0.76
41 0.82
42 0.82
43 0.87
44 0.83
45 0.8
46 0.76