Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4P5S6

Protein Details
Accession F4P5S6    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-55LGYKQKPFKYVKKELCKPKPNPFLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MDASTNSAPQKQKRFLTAKYLHVGYNQGRDLGYKQKPFKYVKKELCKPKPNPFLKAENKNRIELEKKEAEKEAAWLRMEAAAAKLAEHKNLKDKHLLQRQKTKIFLGKKTLKGQPLMVNQIKHLVGKVYKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.61
3 0.65
4 0.63
5 0.6
6 0.58
7 0.55
8 0.46
9 0.41
10 0.43
11 0.35
12 0.35
13 0.29
14 0.25
15 0.23
16 0.24
17 0.25
18 0.29
19 0.33
20 0.34
21 0.39
22 0.43
23 0.5
24 0.55
25 0.61
26 0.62
27 0.65
28 0.67
29 0.72
30 0.77
31 0.8
32 0.84
33 0.85
34 0.82
35 0.82
36 0.82
37 0.76
38 0.73
39 0.66
40 0.66
41 0.64
42 0.69
43 0.67
44 0.66
45 0.64
46 0.61
47 0.57
48 0.5
49 0.46
50 0.38
51 0.35
52 0.32
53 0.31
54 0.3
55 0.3
56 0.28
57 0.23
58 0.24
59 0.22
60 0.18
61 0.18
62 0.16
63 0.16
64 0.16
65 0.15
66 0.12
67 0.09
68 0.08
69 0.08
70 0.08
71 0.13
72 0.12
73 0.17
74 0.19
75 0.2
76 0.26
77 0.3
78 0.32
79 0.35
80 0.4
81 0.46
82 0.54
83 0.61
84 0.6
85 0.67
86 0.73
87 0.71
88 0.68
89 0.63
90 0.61
91 0.6
92 0.59
93 0.59
94 0.59
95 0.6
96 0.65
97 0.65
98 0.62
99 0.57
100 0.55
101 0.53
102 0.51
103 0.54
104 0.51
105 0.46
106 0.43
107 0.45
108 0.42
109 0.34
110 0.29
111 0.25
112 0.24