C4R3T7

UniProt ID: C4R3T7   Organism: Komagataella phaffii (strain GS115 / ATCC 20864)
Gene: PAS_chr3_0194   Protein: Protein component of the large (60S) ribosomal subunit, identical to Rpl42Ap and has similarity to r
Length: 131 AA

Protein Details

• Accession: C4R3T7
• Localization Confidence: Low
• Confidence Score: 7.4
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  2-31	VNVPKTRKTFCKGKQCRKHTQHKVTQYKAG	Hydrophilic

• Subcellular Location(s): mito 10, cyto_nucl 9, nucl 8.5, cyto 8.5
• Family & Domain DBs:
  • InterPro:
    • IPR000552 Ribosomal_L44e
    • IPR011332 Ribosomal_zn-bd
  • Gene Ontology:
    • GO:1990904 C:ribonucleoprotein complex
    • GO:0005840 C:ribosome
    • GO:0003735 F:structural constituent of ribosome
    • GO:0006412 P:translation
  • KEGG:
    • ppa:PAS_chr3_0194 -
  • Pfam:
    • PF00935 Ribosomal_L44
  • PROSITE:
    • PS01172 RIBOSOMAL_L44E
• Amino Acid Sequences: MVNVPKTRKTFCKGKQCRKHTQHKVTQYKAGAASLFAQGKRRYDRKQSGYGGQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLALKRCKHFELGGDKKQKGQALQF

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.79
2, 0.84
3, 0.85
4, 0.89
5, 0.88
6, 0.9
7, 0.9
8, 0.89
9, 0.88
10, 0.88
11, 0.89
12, 0.82
13, 0.79
14, 0.69
15, 0.62
16, 0.52
17, 0.43
18, 0.32
19, 0.23
20, 0.2
21, 0.17
22, 0.18
23, 0.15
24, 0.2
25, 0.21
26, 0.25
27, 0.31
28, 0.37
29, 0.38
30, 0.46
31, 0.54
32, 0.55
33, 0.61
34, 0.59
35, 0.58
36, 0.57
37, 0.58
38, 0.49
39, 0.44
40, 0.4
41, 0.33
42, 0.36
43, 0.37
44, 0.36
45, 0.32
46, 0.4
47, 0.43
48, 0.5
49, 0.6
50, 0.62
51, 0.61
52, 0.65
53, 0.71
54, 0.71
55, 0.7
56, 0.66
57, 0.6
58, 0.57
59, 0.54
60, 0.48
61, 0.42
62, 0.38
63, 0.31
64, 0.27
65, 0.25
66, 0.24
67, 0.28
68, 0.33
69, 0.37
70, 0.42
71, 0.52
72, 0.6
73, 0.64
74, 0.63
75, 0.58
76, 0.55
77, 0.5
78, 0.49
79, 0.49
80, 0.5
81, 0.53
82, 0.59
83, 0.57
84, 0.58
85, 0.61
86, 0.57