Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R3T7

Protein Details
Accession C4R3T7    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNVPKTRKTFCKGKQCRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 9, nucl 8.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ppa:PAS_chr3_0194  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTFCKGKQCRKHTQHKVTQYKAGAASLFAQGKRRYDRKQSGYGGQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLALKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.89
5 0.88
6 0.9
7 0.9
8 0.89
9 0.88
10 0.88
11 0.89
12 0.82
13 0.79
14 0.69
15 0.62
16 0.52
17 0.43
18 0.32
19 0.23
20 0.2
21 0.17
22 0.18
23 0.15
24 0.2
25 0.21
26 0.25
27 0.31
28 0.37
29 0.38
30 0.46
31 0.54
32 0.55
33 0.61
34 0.59
35 0.58
36 0.57
37 0.58
38 0.49
39 0.44
40 0.4
41 0.33
42 0.36
43 0.37
44 0.36
45 0.32
46 0.4
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.66
57 0.6
58 0.57
59 0.54
60 0.48
61 0.42
62 0.38
63 0.31
64 0.27
65 0.25
66 0.24
67 0.28
68 0.33
69 0.37
70 0.42
71 0.52
72 0.6
73 0.64
74 0.63
75 0.58
76 0.55
77 0.5
78 0.49
79 0.49
80 0.5
81 0.53
82 0.59
83 0.57
84 0.58
85 0.61
86 0.57