Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U779

Protein Details
Accession Q0U779    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MPTHYLKRQCQKETKQQIRRRVRNDPSERCRESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
KEGG pno:SNOG_12385  -  
Amino Acid Sequences MPTHYLKRQCQKETKQQIRRRVRNDPSERCRESNNLGTQRNEERERQSELGAQQNTNKGSVSQSQQPGLGYRREREHRTVAANYSTQRGPSQVTVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.86
4 0.87
5 0.88
6 0.89
7 0.85
8 0.84
9 0.82
10 0.83
11 0.84
12 0.84
13 0.81
14 0.81
15 0.77
16 0.69
17 0.63
18 0.56
19 0.51
20 0.48
21 0.49
22 0.46
23 0.45
24 0.44
25 0.44
26 0.45
27 0.45
28 0.4
29 0.34
30 0.32
31 0.32
32 0.36
33 0.33
34 0.29
35 0.26
36 0.26
37 0.29
38 0.26
39 0.23
40 0.21
41 0.24
42 0.24
43 0.21
44 0.2
45 0.13
46 0.15
47 0.18
48 0.19
49 0.22
50 0.24
51 0.24
52 0.25
53 0.25
54 0.27
55 0.26
56 0.29
57 0.26
58 0.27
59 0.35
60 0.41
61 0.45
62 0.47
63 0.51
64 0.49
65 0.52
66 0.52
67 0.47
68 0.44
69 0.43
70 0.38
71 0.36
72 0.32
73 0.28
74 0.26
75 0.24
76 0.24