Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4NW90

Protein Details
Accession F4NW90   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
101-123DESVAKFKKGRQAKRKASSYRIPHydrophilic
NLS Segment(s)
PositionSequence
106-117KFKKGRQAKRKA
Subcellular Location(s) nucl 18.5, cyto_nucl 15.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTDREVAHEALLARHRQENKELIAKTTALKKTIAKGASGKAQKKQVQDQIAQLQNEQAERHSQEIAADTAILDGDIQCESEKVNVALIKDAMDDITLDSKDESVAKFKKGRQAKRKASSYRIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.34
4 0.39
5 0.4
6 0.4
7 0.45
8 0.44
9 0.39
10 0.37
11 0.35
12 0.32
13 0.35
14 0.33
15 0.26
16 0.28
17 0.27
18 0.3
19 0.35
20 0.33
21 0.27
22 0.27
23 0.28
24 0.34
25 0.39
26 0.38
27 0.37
28 0.44
29 0.47
30 0.48
31 0.53
32 0.52
33 0.5
34 0.48
35 0.47
36 0.46
37 0.46
38 0.41
39 0.34
40 0.28
41 0.24
42 0.23
43 0.19
44 0.12
45 0.1
46 0.11
47 0.12
48 0.11
49 0.1
50 0.1
51 0.11
52 0.11
53 0.08
54 0.07
55 0.05
56 0.05
57 0.05
58 0.04
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.06
68 0.07
69 0.07
70 0.09
71 0.1
72 0.11
73 0.12
74 0.12
75 0.12
76 0.11
77 0.1
78 0.08
79 0.07
80 0.06
81 0.06
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.1
88 0.12
89 0.12
90 0.17
91 0.2
92 0.26
93 0.32
94 0.36
95 0.44
96 0.52
97 0.62
98 0.65
99 0.73
100 0.78
101 0.82
102 0.88
103 0.87