Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P0X1

Protein Details
Accession F4P0X1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-92TSDGPSPPHHKKKHIPKDSLKKYRKKAQAQBasic
NLS Segment(s)
PositionSequence
68-89SPPHHKKKHIPKDSLKKYRKKA
Subcellular Location(s) extr 16, mito 3, pero 2, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MQLVSLLFTLACSQLVMAAPSPVLSQSLQELEETPSNTGCCGGFNPFKKIKKPTPKDSQVPGTSDGPSPPHHKKKHIPKDSLKKYRKKAQAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.09
5 0.09
6 0.08
7 0.09
8 0.09
9 0.07
10 0.08
11 0.07
12 0.07
13 0.09
14 0.1
15 0.1
16 0.1
17 0.11
18 0.12
19 0.14
20 0.15
21 0.13
22 0.13
23 0.13
24 0.12
25 0.12
26 0.09
27 0.07
28 0.07
29 0.11
30 0.16
31 0.18
32 0.24
33 0.3
34 0.34
35 0.38
36 0.44
37 0.5
38 0.55
39 0.61
40 0.64
41 0.68
42 0.72
43 0.73
44 0.71
45 0.69
46 0.61
47 0.56
48 0.5
49 0.41
50 0.35
51 0.31
52 0.26
53 0.21
54 0.21
55 0.26
56 0.32
57 0.41
58 0.44
59 0.52
60 0.61
61 0.7
62 0.78
63 0.81
64 0.81
65 0.82
66 0.88
67 0.91
68 0.92
69 0.9
70 0.89
71 0.88
72 0.89