Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P9K9

Protein Details
Accession F4P9K9   
Localization Confidence High
Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKHQKKFKPARKPAKPKVESVQBasic
39-70KVELHKKKVEKAKNRQKEEKREHRRERYSRLABasic
NLS Segment(s)
PositionSequence
4-17QKKFKPARKPAKPK
37-65RRKVELHKKKVEKAKNRQKEEKREHRRER
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences MKHQKKFKPARKPAKPKVESVQFDETARKDFLTGFHRRKVELHKKKVEKAKNRQKEEKREHRRERYSRLAAVMPKLEIIDSIGRGKAYSDTASDSKDAVESVSVIAAPKKVTTVTVTELDTHSLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.87
3 0.81
4 0.8
5 0.78
6 0.7
7 0.66
8 0.62
9 0.52
10 0.5
11 0.48
12 0.4
13 0.33
14 0.3
15 0.24
16 0.18
17 0.17
18 0.21
19 0.23
20 0.32
21 0.33
22 0.38
23 0.39
24 0.4
25 0.43
26 0.49
27 0.54
28 0.55
29 0.6
30 0.64
31 0.68
32 0.74
33 0.79
34 0.78
35 0.77
36 0.78
37 0.79
38 0.79
39 0.81
40 0.84
41 0.83
42 0.85
43 0.85
44 0.85
45 0.84
46 0.85
47 0.87
48 0.87
49 0.88
50 0.83
51 0.8
52 0.78
53 0.71
54 0.62
55 0.54
56 0.48
57 0.39
58 0.35
59 0.29
60 0.19
61 0.16
62 0.14
63 0.12
64 0.09
65 0.09
66 0.08
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.11
75 0.11
76 0.11
77 0.15
78 0.16
79 0.18
80 0.18
81 0.16
82 0.14
83 0.14
84 0.13
85 0.09
86 0.08
87 0.07
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.09
94 0.1
95 0.1
96 0.11
97 0.11
98 0.12
99 0.14
100 0.17
101 0.19
102 0.22
103 0.23
104 0.23
105 0.24