Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P2N5

Protein Details
Accession F4P2N5   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-39LSKNARKRLLKEKRWIEGKADRKAKFKQEREAMRQKRLBasic
NLS Segment(s)
PositionSequence
5-51NARKRLLKEKRWIEGKADRKAKFKQEREAMRQKRLAEGLSANPSRKK
Subcellular Location(s) nucl 22, cyto_nucl 12.833, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR028564  MT_TRM10-typ  
IPR038459  MT_TRM10-typ_sf  
IPR007356  tRNA_m1G_MeTrfase_euk  
IPR016009  tRNA_MeTrfase_TRMD/TRM10  
Gene Ontology GO:0005634  C:nucleus  
GO:0052905  F:tRNA (guanine(9)-N(1))-methyltransferase activity  
GO:0009019  F:tRNA (guanine-N1-)-methyltransferase activity  
GO:0000049  F:tRNA binding  
GO:0002939  P:tRNA N1-guanine methylation  
Pfam View protein in Pfam  
PF01746  tRNA_m1G_MT  
PROSITE View protein in PROSITE  
PS51675  SAM_MT_TRM10  
Amino Acid Sequences GLSKNARKRLLKEKRWIEGKADRKAKFKQEREAMRQKRLAEGLSANPSRKKNKIDQENSGIRIAIDCNFEKYMTDQEIKSTIVQLGFCYSVNRKQPKRLDLSATSFTPLLQKLMAERTPTYSNWRNFEFHSGHYSEVYEPTNCVYLTADSPNTLQELDPTKVYIVGGIVDRNRHKSLCFNDALKTGVSHAKLPLSSYVDMPSRKVLTINHVVEILVNYANSGNWEDAFLKVLPVRKGAKSKASES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.76
4 0.72
5 0.71
6 0.7
7 0.69
8 0.69
9 0.64
10 0.64
11 0.69
12 0.72
13 0.73
14 0.71
15 0.71
16 0.71
17 0.77
18 0.8
19 0.84
20 0.8
21 0.78
22 0.76
23 0.67
24 0.63
25 0.56
26 0.47
27 0.4
28 0.36
29 0.32
30 0.36
31 0.38
32 0.35
33 0.38
34 0.43
35 0.46
36 0.49
37 0.5
38 0.51
39 0.58
40 0.67
41 0.67
42 0.69
43 0.72
44 0.71
45 0.68
46 0.59
47 0.48
48 0.37
49 0.31
50 0.25
51 0.18
52 0.16
53 0.14
54 0.16
55 0.17
56 0.17
57 0.17
58 0.17
59 0.19
60 0.19
61 0.21
62 0.18
63 0.18
64 0.2
65 0.21
66 0.19
67 0.16
68 0.14
69 0.12
70 0.13
71 0.11
72 0.11
73 0.11
74 0.11
75 0.12
76 0.13
77 0.18
78 0.26
79 0.35
80 0.36
81 0.44
82 0.51
83 0.55
84 0.6
85 0.57
86 0.55
87 0.5
88 0.53
89 0.47
90 0.41
91 0.35
92 0.27
93 0.24
94 0.2
95 0.16
96 0.12
97 0.08
98 0.08
99 0.08
100 0.12
101 0.14
102 0.13
103 0.13
104 0.16
105 0.18
106 0.19
107 0.25
108 0.28
109 0.3
110 0.31
111 0.33
112 0.31
113 0.29
114 0.35
115 0.29
116 0.23
117 0.24
118 0.22
119 0.2
120 0.19
121 0.19
122 0.14
123 0.14
124 0.14
125 0.1
126 0.1
127 0.1
128 0.11
129 0.1
130 0.1
131 0.09
132 0.08
133 0.1
134 0.12
135 0.12
136 0.11
137 0.11
138 0.11
139 0.11
140 0.1
141 0.08
142 0.1
143 0.14
144 0.14
145 0.14
146 0.15
147 0.14
148 0.14
149 0.14
150 0.11
151 0.06
152 0.07
153 0.07
154 0.09
155 0.1
156 0.15
157 0.17
158 0.22
159 0.24
160 0.24
161 0.24
162 0.29
163 0.33
164 0.35
165 0.36
166 0.33
167 0.33
168 0.34
169 0.34
170 0.27
171 0.23
172 0.18
173 0.19
174 0.18
175 0.17
176 0.17
177 0.19
178 0.19
179 0.2
180 0.22
181 0.22
182 0.21
183 0.21
184 0.23
185 0.25
186 0.26
187 0.26
188 0.27
189 0.24
190 0.24
191 0.25
192 0.23
193 0.25
194 0.34
195 0.34
196 0.3
197 0.29
198 0.28
199 0.26
200 0.26
201 0.2
202 0.11
203 0.09
204 0.09
205 0.09
206 0.09
207 0.1
208 0.11
209 0.1
210 0.1
211 0.12
212 0.13
213 0.13
214 0.16
215 0.14
216 0.15
217 0.17
218 0.23
219 0.22
220 0.28
221 0.32
222 0.36
223 0.44
224 0.47
225 0.54