Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P2H0

Protein Details
Accession F4P2H0   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
76-106LYPLSPSPTPPPKKKKRKEIPLPQTPPKKITHydrophilic
NLS Segment(s)
PositionSequence
84-106TPPPKKKKRKEIPLPQTPPKKIT
Subcellular Location(s) mito 18, nucl 4.5, cyto_nucl 3.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MGVRGDSGATGGHRLRGTPPIYRLRLVYIGVRPSLRLPPFVAGSRPRYPPLNPHFFLLARFARSARARFGPGGPPLYPLSPSPTPPPKKKKRKEIPLPQTPPKKITRNHKIPSQYNTLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.26
4 0.28
5 0.3
6 0.36
7 0.4
8 0.43
9 0.43
10 0.41
11 0.38
12 0.38
13 0.33
14 0.31
15 0.26
16 0.26
17 0.27
18 0.26
19 0.23
20 0.23
21 0.28
22 0.24
23 0.22
24 0.21
25 0.21
26 0.24
27 0.24
28 0.26
29 0.23
30 0.29
31 0.31
32 0.32
33 0.32
34 0.32
35 0.31
36 0.37
37 0.4
38 0.42
39 0.38
40 0.37
41 0.37
42 0.34
43 0.34
44 0.29
45 0.23
46 0.16
47 0.16
48 0.15
49 0.18
50 0.2
51 0.21
52 0.2
53 0.21
54 0.21
55 0.22
56 0.24
57 0.23
58 0.23
59 0.25
60 0.22
61 0.22
62 0.21
63 0.21
64 0.2
65 0.16
66 0.2
67 0.18
68 0.2
69 0.25
70 0.33
71 0.4
72 0.49
73 0.6
74 0.64
75 0.74
76 0.82
77 0.87
78 0.88
79 0.91
80 0.93
81 0.93
82 0.93
83 0.93
84 0.91
85 0.89
86 0.88
87 0.8
88 0.75
89 0.72
90 0.7
91 0.66
92 0.69
93 0.71
94 0.72
95 0.74
96 0.77
97 0.78
98 0.77
99 0.76