Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UFA0

Protein Details
Accession Q0UFA0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKVPWRLSRHQKYRQRERLRHVDSIHydrophilic
77-103KYSVFDRKVKRYRKGIHKVPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-94KVKRYRKGIHK
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG pno:SNOG_09564  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRLTNPLSGGLLWKVPWRLSRHQKYRQRERLRHVDSIVATLDNALARKGQSMKKVERWKVEMPTEEEMLPKDKYSVFDRKVKRYRKGIHKVPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.16
5 0.17
6 0.19
7 0.25
8 0.29
9 0.38
10 0.48
11 0.58
12 0.64
13 0.72
14 0.79
15 0.84
16 0.88
17 0.89
18 0.89
19 0.86
20 0.84
21 0.85
22 0.81
23 0.74
24 0.63
25 0.57
26 0.46
27 0.4
28 0.32
29 0.21
30 0.15
31 0.11
32 0.11
33 0.07
34 0.07
35 0.06
36 0.06
37 0.06
38 0.08
39 0.12
40 0.15
41 0.2
42 0.26
43 0.3
44 0.38
45 0.47
46 0.5
47 0.5
48 0.52
49 0.51
50 0.5
51 0.49
52 0.44
53 0.39
54 0.37
55 0.33
56 0.28
57 0.24
58 0.2
59 0.2
60 0.17
61 0.13
62 0.12
63 0.13
64 0.16
65 0.21
66 0.29
67 0.31
68 0.39
69 0.45
70 0.54
71 0.62
72 0.68
73 0.71
74 0.72
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79