Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P6Z2

Protein Details
Accession F4P6Z2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MRDKWRKKRQRRLKRKRRKMRARSKGDACIMBasic
NLS Segment(s)
PositionSequence
4-25KWRKKRQRRLKRKRRKMRARSK
Subcellular Location(s) mito 14, mito_nucl 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
IPR007836  Ribosomal_L41  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF09784  L31  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRDKWRKKRQRRLKRKRRKMRARSKGDACIMHDLLMVSLGVSCRKRRFGLTIGQKYRLRQRLRGVDEVINTLVDSGVQLRALEFAKRIPKESDMTPFEKYWVKSKRFKDGFKPIHWVPKWTRAPHPRTWSPSIYHQSVIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.97
7 0.97
8 0.96
9 0.94
10 0.93
11 0.88
12 0.84
13 0.78
14 0.7
15 0.61
16 0.57
17 0.48
18 0.38
19 0.33
20 0.25
21 0.19
22 0.16
23 0.13
24 0.06
25 0.06
26 0.06
27 0.1
28 0.12
29 0.17
30 0.2
31 0.24
32 0.26
33 0.28
34 0.32
35 0.32
36 0.39
37 0.45
38 0.52
39 0.51
40 0.57
41 0.56
42 0.53
43 0.58
44 0.57
45 0.5
46 0.45
47 0.5
48 0.53
49 0.56
50 0.57
51 0.5
52 0.44
53 0.41
54 0.37
55 0.29
56 0.19
57 0.14
58 0.11
59 0.07
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.06
68 0.07
69 0.08
70 0.07
71 0.11
72 0.18
73 0.19
74 0.22
75 0.22
76 0.24
77 0.27
78 0.29
79 0.33
80 0.3
81 0.32
82 0.32
83 0.3
84 0.3
85 0.32
86 0.31
87 0.32
88 0.37
89 0.4
90 0.46
91 0.5
92 0.59
93 0.62
94 0.66
95 0.66
96 0.68
97 0.7
98 0.65
99 0.68
100 0.6
101 0.63
102 0.59
103 0.56
104 0.5
105 0.53
106 0.57
107 0.55
108 0.62
109 0.62
110 0.67
111 0.7
112 0.74
113 0.72
114 0.71
115 0.73
116 0.67
117 0.61
118 0.65
119 0.62
120 0.56
121 0.51