Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P9U9

Protein Details
Accession F4P9U9   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-77YDDYHRRMRKLEKRKIAKEEERLABasic
NLS Segment(s)
PositionSequence
60-69RMRKLEKRKI
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008698  NDUB7  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0005747  C:mitochondrial respiratory chain complex I  
Pfam View protein in Pfam  
PF05676  NDUF_B7  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MYITQEELNKTQIPLQWRDYCVHLLSELNQCRRESYFAPWKCVEEKLAWQKCQYDDYHRRMRKLEKRKIAKEEERLAAAVSDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.37
4 0.38
5 0.39
6 0.37
7 0.37
8 0.33
9 0.28
10 0.22
11 0.17
12 0.18
13 0.25
14 0.28
15 0.29
16 0.31
17 0.3
18 0.31
19 0.32
20 0.32
21 0.25
22 0.27
23 0.34
24 0.32
25 0.37
26 0.36
27 0.36
28 0.34
29 0.33
30 0.27
31 0.19
32 0.24
33 0.3
34 0.35
35 0.35
36 0.34
37 0.37
38 0.36
39 0.39
40 0.33
41 0.33
42 0.36
43 0.43
44 0.53
45 0.53
46 0.55
47 0.57
48 0.65
49 0.65
50 0.67
51 0.7
52 0.7
53 0.77
54 0.82
55 0.85
56 0.85
57 0.83
58 0.81
59 0.79
60 0.72
61 0.63
62 0.55
63 0.47