Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SUY2

Protein Details
Accession Q8SUY2   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-43VDIPVRKKPSKPLKRSRSLKIKKDABasic
NLS Segment(s)
PositionSequence
24-58RKKPSKPLKRSRSLKIKKDAMTPRKIETPKKKVRI
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
KEGG ecu:ECU07_1160  -  
Amino Acid Sequences MKNPRTWSAKECFKKVNSVDIPVRKKPSKPLKRSRSLKIKKDAMTPRKIETPKKKVRILSPGSRVEIMGGPESKRYISARKINFND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.56
3 0.58
4 0.5
5 0.5
6 0.52
7 0.53
8 0.57
9 0.54
10 0.61
11 0.54
12 0.54
13 0.57
14 0.61
15 0.63
16 0.67
17 0.72
18 0.75
19 0.82
20 0.86
21 0.85
22 0.85
23 0.83
24 0.81
25 0.79
26 0.76
27 0.67
28 0.7
29 0.7
30 0.66
31 0.63
32 0.57
33 0.51
34 0.51
35 0.53
36 0.53
37 0.54
38 0.57
39 0.6
40 0.66
41 0.68
42 0.65
43 0.67
44 0.68
45 0.65
46 0.63
47 0.61
48 0.58
49 0.55
50 0.51
51 0.45
52 0.36
53 0.31
54 0.24
55 0.21
56 0.19
57 0.17
58 0.19
59 0.2
60 0.19
61 0.2
62 0.22
63 0.25
64 0.32
65 0.41
66 0.47