Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SS53

Protein Details
Accession Q8SS53    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
85-107ANYVHYSKKYKRYSRRHTNFSVHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 11.166, nucl 9.5, cyto_nucl 8.833, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR032440  Ribosomal_S11_N  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ecu:ECU04_0640  -  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
PF16205  Ribosomal_S17_N  
Amino Acid Sequences MEEVRKLKVFPRQTGVCAKPYASHEEQPKRRVNAEVCGFKAPETAYTRQYIDKKCPFTGDVNVRGRLFKGVVKKMKAEKTIVVVANYVHYSKKYKRYSRRHTNFSVHMSPCFEGMINVGDTVICGETRPLSKTKSSVVLGYIKKALPGSFKVLESI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.52
4 0.46
5 0.41
6 0.37
7 0.37
8 0.41
9 0.36
10 0.39
11 0.44
12 0.53
13 0.59
14 0.62
15 0.67
16 0.62
17 0.6
18 0.61
19 0.54
20 0.53
21 0.54
22 0.51
23 0.45
24 0.44
25 0.42
26 0.35
27 0.34
28 0.25
29 0.23
30 0.23
31 0.24
32 0.24
33 0.26
34 0.27
35 0.31
36 0.37
37 0.35
38 0.39
39 0.43
40 0.45
41 0.44
42 0.44
43 0.41
44 0.37
45 0.41
46 0.38
47 0.4
48 0.39
49 0.41
50 0.39
51 0.37
52 0.35
53 0.28
54 0.23
55 0.17
56 0.2
57 0.26
58 0.31
59 0.32
60 0.36
61 0.41
62 0.45
63 0.44
64 0.39
65 0.32
66 0.3
67 0.33
68 0.29
69 0.23
70 0.18
71 0.16
72 0.16
73 0.15
74 0.12
75 0.08
76 0.09
77 0.14
78 0.19
79 0.29
80 0.37
81 0.46
82 0.56
83 0.67
84 0.77
85 0.83
86 0.86
87 0.84
88 0.81
89 0.78
90 0.73
91 0.69
92 0.65
93 0.55
94 0.48
95 0.43
96 0.36
97 0.3
98 0.24
99 0.18
100 0.1
101 0.1
102 0.11
103 0.09
104 0.08
105 0.08
106 0.07
107 0.07
108 0.08
109 0.07
110 0.05
111 0.05
112 0.06
113 0.09
114 0.12
115 0.15
116 0.17
117 0.2
118 0.24
119 0.26
120 0.3
121 0.33
122 0.33
123 0.31
124 0.32
125 0.37
126 0.35
127 0.36
128 0.36
129 0.29
130 0.29
131 0.29
132 0.28
133 0.25
134 0.27
135 0.3
136 0.3