Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P9Z2

Protein Details
Accession F4P9Z2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
226-250KERLAESKEIRRKKRQEYNDHTDLVHydrophilic
NLS Segment(s)
PositionSequence
235-239IRRKK
Subcellular Location(s) nucl 6.5, cyto_nucl 5.5, E.R. 5, extr 4, golg 4, cyto 3.5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MKLVDILFVLSAAVTVNAVLVPFKKDGSLQSSGTSSQVSDPTNEPNPGTSNEYQQEPMDLSFSGRTRQRTVIVAGPNTYSQGQRQTVIVAGPNTSSQGQRQTVIVAGPSTSSQVQQSANEPSSGIPDQNQQHPTGQSGSSTSEEYWKRLSDIIDSSTSKRSRKRPINESSPSSSKRIRQQPIDQPGPSTSSQVHEQPMSQDESANTSSNQMTGLNERDQKVLDRIKERLAESKEIRRKKRQEYNDHTDLVLNQQLALARGEDISESKYDPKDEIRLKQECRKASIRVHGITQELKRFMTKHGLEFEEPSSDSDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.05
6 0.06
7 0.07
8 0.11
9 0.12
10 0.12
11 0.13
12 0.15
13 0.19
14 0.24
15 0.28
16 0.25
17 0.27
18 0.28
19 0.28
20 0.27
21 0.23
22 0.18
23 0.16
24 0.19
25 0.18
26 0.19
27 0.2
28 0.25
29 0.29
30 0.3
31 0.27
32 0.25
33 0.27
34 0.27
35 0.32
36 0.28
37 0.3
38 0.31
39 0.32
40 0.32
41 0.29
42 0.28
43 0.22
44 0.21
45 0.15
46 0.13
47 0.12
48 0.15
49 0.16
50 0.19
51 0.22
52 0.26
53 0.29
54 0.32
55 0.33
56 0.32
57 0.35
58 0.35
59 0.36
60 0.34
61 0.31
62 0.29
63 0.26
64 0.25
65 0.23
66 0.18
67 0.15
68 0.21
69 0.21
70 0.21
71 0.21
72 0.2
73 0.2
74 0.19
75 0.2
76 0.13
77 0.12
78 0.12
79 0.12
80 0.12
81 0.12
82 0.13
83 0.12
84 0.18
85 0.19
86 0.19
87 0.19
88 0.18
89 0.18
90 0.18
91 0.16
92 0.1
93 0.08
94 0.08
95 0.08
96 0.09
97 0.08
98 0.08
99 0.08
100 0.11
101 0.12
102 0.12
103 0.15
104 0.18
105 0.18
106 0.17
107 0.17
108 0.15
109 0.17
110 0.17
111 0.14
112 0.11
113 0.16
114 0.18
115 0.24
116 0.25
117 0.23
118 0.24
119 0.25
120 0.25
121 0.21
122 0.19
123 0.14
124 0.13
125 0.14
126 0.13
127 0.13
128 0.12
129 0.17
130 0.17
131 0.18
132 0.19
133 0.17
134 0.17
135 0.18
136 0.18
137 0.14
138 0.15
139 0.16
140 0.17
141 0.18
142 0.19
143 0.23
144 0.26
145 0.27
146 0.32
147 0.38
148 0.45
149 0.54
150 0.6
151 0.63
152 0.68
153 0.74
154 0.73
155 0.7
156 0.64
157 0.6
158 0.54
159 0.48
160 0.44
161 0.39
162 0.43
163 0.47
164 0.48
165 0.48
166 0.54
167 0.6
168 0.65
169 0.65
170 0.57
171 0.49
172 0.44
173 0.41
174 0.33
175 0.26
176 0.18
177 0.15
178 0.17
179 0.18
180 0.19
181 0.16
182 0.16
183 0.16
184 0.18
185 0.18
186 0.16
187 0.15
188 0.13
189 0.17
190 0.18
191 0.17
192 0.15
193 0.14
194 0.14
195 0.13
196 0.14
197 0.1
198 0.1
199 0.12
200 0.15
201 0.18
202 0.22
203 0.23
204 0.23
205 0.24
206 0.25
207 0.28
208 0.3
209 0.31
210 0.31
211 0.32
212 0.36
213 0.39
214 0.39
215 0.4
216 0.38
217 0.41
218 0.41
219 0.49
220 0.53
221 0.58
222 0.65
223 0.67
224 0.72
225 0.75
226 0.81
227 0.81
228 0.84
229 0.84
230 0.86
231 0.81
232 0.73
233 0.63
234 0.54
235 0.44
236 0.36
237 0.29
238 0.2
239 0.14
240 0.14
241 0.14
242 0.14
243 0.14
244 0.11
245 0.09
246 0.09
247 0.09
248 0.09
249 0.09
250 0.1
251 0.1
252 0.12
253 0.16
254 0.18
255 0.19
256 0.21
257 0.24
258 0.31
259 0.37
260 0.42
261 0.47
262 0.52
263 0.57
264 0.64
265 0.67
266 0.62
267 0.63
268 0.61
269 0.59
270 0.59
271 0.62
272 0.61
273 0.56
274 0.55
275 0.51
276 0.49
277 0.49
278 0.47
279 0.44
280 0.38
281 0.38
282 0.38
283 0.36
284 0.37
285 0.4
286 0.38
287 0.37
288 0.42
289 0.45
290 0.43
291 0.45
292 0.43
293 0.36
294 0.34