Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P548

Protein Details
Accession F4P548   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
121-152NESFRGKHEKMKRLKQECKEAKQKEKDLKKELBasic
NLS Segment(s)
PositionSequence
126-174GKHEKMKRLKQECKEAKQKEKDLKKELGKRPSSGWGNRLKRLKKMFTKH
Subcellular Location(s) nucl 7golg 7, extr 5, E.R. 5, mito 2
Family & Domain DBs
Amino Acid Sequences MKFIDIILVLSVSAVASALVATPNAETRSHQLSKRSPGKGWEKLVEDNPNDDDASEPGPSNDGNSVESRLADAKRQREDICDKYRKYKNSLWRDGLEYGLTGEVLMSNQSPTEYYGNVDSNESFRGKHEKMKRLKQECKEAKQKEKDLKKELGKRPSSGWGNRLKRLKKMFTKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.09
11 0.11
12 0.12
13 0.13
14 0.17
15 0.25
16 0.3
17 0.32
18 0.37
19 0.42
20 0.52
21 0.59
22 0.58
23 0.52
24 0.56
25 0.62
26 0.62
27 0.6
28 0.55
29 0.5
30 0.5
31 0.53
32 0.51
33 0.43
34 0.37
35 0.34
36 0.3
37 0.26
38 0.22
39 0.18
40 0.12
41 0.13
42 0.11
43 0.1
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.09
50 0.1
51 0.11
52 0.12
53 0.12
54 0.12
55 0.12
56 0.13
57 0.13
58 0.16
59 0.2
60 0.24
61 0.27
62 0.3
63 0.3
64 0.32
65 0.38
66 0.41
67 0.45
68 0.47
69 0.45
70 0.51
71 0.57
72 0.55
73 0.55
74 0.53
75 0.54
76 0.57
77 0.62
78 0.57
79 0.53
80 0.52
81 0.47
82 0.41
83 0.31
84 0.21
85 0.14
86 0.1
87 0.08
88 0.05
89 0.04
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.07
99 0.09
100 0.08
101 0.09
102 0.12
103 0.14
104 0.14
105 0.15
106 0.13
107 0.13
108 0.15
109 0.15
110 0.12
111 0.13
112 0.21
113 0.22
114 0.3
115 0.38
116 0.45
117 0.54
118 0.64
119 0.72
120 0.74
121 0.82
122 0.81
123 0.83
124 0.83
125 0.83
126 0.83
127 0.81
128 0.82
129 0.82
130 0.83
131 0.82
132 0.82
133 0.82
134 0.79
135 0.79
136 0.78
137 0.79
138 0.79
139 0.79
140 0.74
141 0.67
142 0.64
143 0.65
144 0.63
145 0.58
146 0.56
147 0.57
148 0.59
149 0.65
150 0.71
151 0.66
152 0.67
153 0.71
154 0.74