Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4NRW1

Protein Details
Accession F4NRW1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
245-274KYALPPTKSKKPTKEEKKPKLEEKKKDDAFBasic
NLS Segment(s)
PositionSequence
250-271PTKSKKPTKEEKKPKLEEKKKD
Subcellular Location(s) cyto 9.5, cyto_nucl 8.333, nucl 6, mito_nucl 5.833, mito 4.5, vacu 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR044569  PDIA6-like  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0005788  C:endoplasmic reticulum lumen  
GO:0003756  F:protein disulfide isomerase activity  
GO:0015035  F:protein-disulfide reductase activity  
GO:0034976  P:response to endoplasmic reticulum stress  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
Amino Acid Sequences MMKSVATLGCLLAFLAHTVSAGLYTAKDNVISVNSNNFNSVVMDTEHPVAVEFYAPWCGHCKQLAPEYVKAATSLQGLAKLVAVDCDEQSNQALCGRFGVKGFPTIKVFSGGIKGMPEDYNGERKSKAIVDYLISKITHKYVKQIGIIGKKTVSLEDFVKENDMPRMVFVNKKDTTSPLLKALSVEYKDRLTVGEVKGAYTKFVEKITTKIPGVFIWPKDTGITDTPVEYEGELKQKPLKEFLEKYALPPTKSKKPTKEEKKPKLEEKKKDDAFKKPLDLNIPELKSQTDLEELCLDQSGVCVISFIANDKEYPEFVAEHLTHLNIIQNVKQTMHKKPHNPFTFVQVNPLQHGLQLVKDFQASDMYPSILAVNFKRKAYGLLRAAFEEESITKFLTDLISGKGSISKFDLVPTLDKGDKAKADAPVRDGEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.06
8 0.07
9 0.07
10 0.07
11 0.09
12 0.11
13 0.11
14 0.11
15 0.11
16 0.12
17 0.15
18 0.16
19 0.17
20 0.23
21 0.26
22 0.26
23 0.27
24 0.26
25 0.23
26 0.22
27 0.21
28 0.15
29 0.13
30 0.14
31 0.15
32 0.17
33 0.16
34 0.14
35 0.14
36 0.13
37 0.11
38 0.1
39 0.09
40 0.08
41 0.14
42 0.14
43 0.15
44 0.19
45 0.2
46 0.23
47 0.25
48 0.28
49 0.28
50 0.35
51 0.42
52 0.42
53 0.43
54 0.43
55 0.42
56 0.38
57 0.34
58 0.27
59 0.21
60 0.17
61 0.17
62 0.13
63 0.14
64 0.14
65 0.14
66 0.14
67 0.12
68 0.11
69 0.1
70 0.11
71 0.1
72 0.1
73 0.12
74 0.11
75 0.12
76 0.14
77 0.13
78 0.13
79 0.15
80 0.15
81 0.13
82 0.16
83 0.16
84 0.16
85 0.15
86 0.18
87 0.16
88 0.22
89 0.24
90 0.24
91 0.26
92 0.26
93 0.27
94 0.26
95 0.25
96 0.19
97 0.2
98 0.17
99 0.15
100 0.14
101 0.14
102 0.13
103 0.13
104 0.13
105 0.13
106 0.15
107 0.23
108 0.24
109 0.25
110 0.24
111 0.24
112 0.26
113 0.26
114 0.25
115 0.19
116 0.2
117 0.2
118 0.23
119 0.24
120 0.24
121 0.21
122 0.2
123 0.19
124 0.21
125 0.24
126 0.2
127 0.25
128 0.28
129 0.32
130 0.33
131 0.36
132 0.38
133 0.4
134 0.41
135 0.36
136 0.3
137 0.28
138 0.27
139 0.23
140 0.18
141 0.13
142 0.13
143 0.13
144 0.14
145 0.12
146 0.14
147 0.13
148 0.14
149 0.14
150 0.13
151 0.12
152 0.12
153 0.15
154 0.14
155 0.18
156 0.18
157 0.25
158 0.25
159 0.26
160 0.27
161 0.25
162 0.29
163 0.29
164 0.28
165 0.24
166 0.23
167 0.22
168 0.21
169 0.21
170 0.21
171 0.19
172 0.19
173 0.16
174 0.16
175 0.16
176 0.15
177 0.14
178 0.11
179 0.16
180 0.15
181 0.18
182 0.17
183 0.18
184 0.2
185 0.2
186 0.18
187 0.13
188 0.14
189 0.11
190 0.12
191 0.14
192 0.12
193 0.14
194 0.16
195 0.19
196 0.18
197 0.17
198 0.17
199 0.15
200 0.19
201 0.2
202 0.18
203 0.18
204 0.19
205 0.18
206 0.17
207 0.18
208 0.15
209 0.13
210 0.15
211 0.11
212 0.11
213 0.11
214 0.11
215 0.11
216 0.09
217 0.09
218 0.08
219 0.12
220 0.12
221 0.13
222 0.16
223 0.19
224 0.2
225 0.24
226 0.25
227 0.28
228 0.3
229 0.32
230 0.37
231 0.33
232 0.34
233 0.38
234 0.37
235 0.32
236 0.35
237 0.38
238 0.4
239 0.48
240 0.54
241 0.54
242 0.6
243 0.7
244 0.75
245 0.81
246 0.83
247 0.85
248 0.88
249 0.86
250 0.88
251 0.88
252 0.87
253 0.85
254 0.82
255 0.82
256 0.77
257 0.78
258 0.73
259 0.71
260 0.69
261 0.63
262 0.59
263 0.51
264 0.49
265 0.45
266 0.42
267 0.38
268 0.38
269 0.35
270 0.31
271 0.29
272 0.27
273 0.23
274 0.22
275 0.18
276 0.14
277 0.12
278 0.13
279 0.14
280 0.14
281 0.12
282 0.12
283 0.11
284 0.08
285 0.07
286 0.06
287 0.05
288 0.05
289 0.05
290 0.05
291 0.06
292 0.06
293 0.08
294 0.1
295 0.1
296 0.1
297 0.12
298 0.13
299 0.12
300 0.13
301 0.12
302 0.1
303 0.1
304 0.16
305 0.14
306 0.15
307 0.16
308 0.15
309 0.13
310 0.13
311 0.16
312 0.13
313 0.14
314 0.14
315 0.18
316 0.19
317 0.21
318 0.27
319 0.29
320 0.36
321 0.45
322 0.5
323 0.55
324 0.62
325 0.71
326 0.71
327 0.71
328 0.63
329 0.61
330 0.62
331 0.53
332 0.5
333 0.44
334 0.4
335 0.36
336 0.37
337 0.29
338 0.21
339 0.24
340 0.18
341 0.16
342 0.17
343 0.16
344 0.15
345 0.16
346 0.16
347 0.14
348 0.17
349 0.14
350 0.16
351 0.16
352 0.15
353 0.15
354 0.15
355 0.15
356 0.13
357 0.16
358 0.16
359 0.24
360 0.27
361 0.28
362 0.29
363 0.29
364 0.34
365 0.36
366 0.41
367 0.39
368 0.4
369 0.42
370 0.41
371 0.43
372 0.36
373 0.31
374 0.24
375 0.18
376 0.16
377 0.15
378 0.14
379 0.12
380 0.12
381 0.13
382 0.12
383 0.12
384 0.12
385 0.14
386 0.15
387 0.15
388 0.16
389 0.2
390 0.19
391 0.19
392 0.21
393 0.21
394 0.19
395 0.21
396 0.24
397 0.22
398 0.25
399 0.26
400 0.28
401 0.27
402 0.29
403 0.3
404 0.32
405 0.32
406 0.34
407 0.35
408 0.38
409 0.43
410 0.45
411 0.46