Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4PFD9

Protein Details
Accession F4PFD9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
169-195SPSSNRGSAEKRRPARNQRQQAQASGKHydrophilic
NLS Segment(s)
PositionSequence
179-182KRRP
Subcellular Location(s) nucl 21, cyto_nucl 15.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024623  YtxH  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12732  YtxH  
Amino Acid Sequences MTEQNKQEMQNSQETQENVEVMDKVYTKKDVIKGGIIGWGLGVATTILLAPKSGKELRGDITYQVGSAKDKAVDKSRELSDSAMEKYAAIKDSATNKTKELKDKISVGKNKPSNGAKSEEEDTENESQLQYNEMEKAMGNEQEEEQNQQKKQNSDASSDQKTKANSKSSPSSNRGSAEKRRPARNQRQQAQASGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.34
4 0.29
5 0.2
6 0.2
7 0.19
8 0.14
9 0.17
10 0.15
11 0.15
12 0.18
13 0.19
14 0.19
15 0.25
16 0.29
17 0.31
18 0.33
19 0.34
20 0.32
21 0.3
22 0.31
23 0.25
24 0.2
25 0.14
26 0.11
27 0.08
28 0.07
29 0.06
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.05
38 0.06
39 0.11
40 0.13
41 0.15
42 0.17
43 0.19
44 0.22
45 0.24
46 0.24
47 0.2
48 0.21
49 0.19
50 0.17
51 0.15
52 0.13
53 0.11
54 0.12
55 0.12
56 0.12
57 0.14
58 0.17
59 0.23
60 0.26
61 0.26
62 0.3
63 0.3
64 0.29
65 0.28
66 0.25
67 0.2
68 0.2
69 0.19
70 0.15
71 0.13
72 0.12
73 0.12
74 0.13
75 0.11
76 0.09
77 0.08
78 0.1
79 0.16
80 0.22
81 0.23
82 0.23
83 0.24
84 0.3
85 0.33
86 0.37
87 0.35
88 0.34
89 0.34
90 0.38
91 0.43
92 0.45
93 0.49
94 0.46
95 0.5
96 0.49
97 0.47
98 0.48
99 0.46
100 0.41
101 0.37
102 0.38
103 0.31
104 0.31
105 0.31
106 0.27
107 0.25
108 0.21
109 0.22
110 0.19
111 0.18
112 0.15
113 0.13
114 0.13
115 0.11
116 0.12
117 0.09
118 0.09
119 0.09
120 0.09
121 0.1
122 0.09
123 0.11
124 0.11
125 0.12
126 0.12
127 0.12
128 0.13
129 0.16
130 0.17
131 0.19
132 0.23
133 0.28
134 0.29
135 0.34
136 0.38
137 0.37
138 0.41
139 0.46
140 0.42
141 0.41
142 0.48
143 0.48
144 0.51
145 0.52
146 0.5
147 0.45
148 0.46
149 0.47
150 0.46
151 0.47
152 0.43
153 0.46
154 0.53
155 0.57
156 0.62
157 0.61
158 0.59
159 0.56
160 0.56
161 0.56
162 0.55
163 0.56
164 0.58
165 0.63
166 0.66
167 0.71
168 0.78
169 0.83
170 0.86
171 0.87
172 0.88
173 0.86
174 0.88
175 0.83