Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P1G0

Protein Details
Accession F4P1G0    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
125-156LKAKEMEKTNKNREKRLKRKRNNEKTKPIMVGBasic
NLS Segment(s)
PositionSequence
131-150EKTNKNREKRLKRKRNNEKT
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003725  F:double-stranded RNA binding  
GO:0019901  F:protein kinase binding  
GO:0004860  F:protein kinase inhibitor activity  
GO:0006469  P:negative regulation of protein kinase activity  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSAKNTDQPAKTEDASGDENDSDRGRKVRPKTALDTQKAQVEKLMKRIDKEIILPTRPSDTPRGPRKEGAHVVRNIQGSSAGAGSGEFHVYRALRRKEYTRLKALDDAAQKEEDRIEYESRQQTLKAKEMEKTNKNREKRLKRKRNNEKTKPIMVGPALSSVEPERQADQQTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.25
4 0.23
5 0.19
6 0.19
7 0.19
8 0.2
9 0.17
10 0.17
11 0.2
12 0.23
13 0.31
14 0.37
15 0.44
16 0.51
17 0.56
18 0.6
19 0.67
20 0.71
21 0.68
22 0.66
23 0.59
24 0.57
25 0.51
26 0.44
27 0.37
28 0.35
29 0.32
30 0.35
31 0.41
32 0.36
33 0.38
34 0.41
35 0.4
36 0.35
37 0.35
38 0.35
39 0.32
40 0.32
41 0.31
42 0.29
43 0.3
44 0.29
45 0.28
46 0.27
47 0.28
48 0.36
49 0.45
50 0.5
51 0.49
52 0.54
53 0.54
54 0.56
55 0.57
56 0.53
57 0.51
58 0.46
59 0.45
60 0.44
61 0.41
62 0.33
63 0.25
64 0.2
65 0.13
66 0.12
67 0.1
68 0.05
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.06
77 0.07
78 0.1
79 0.18
80 0.21
81 0.24
82 0.26
83 0.3
84 0.38
85 0.48
86 0.51
87 0.5
88 0.49
89 0.48
90 0.49
91 0.47
92 0.43
93 0.37
94 0.33
95 0.27
96 0.26
97 0.24
98 0.21
99 0.2
100 0.15
101 0.14
102 0.14
103 0.15
104 0.15
105 0.22
106 0.26
107 0.27
108 0.27
109 0.26
110 0.3
111 0.32
112 0.37
113 0.36
114 0.34
115 0.37
116 0.45
117 0.53
118 0.55
119 0.6
120 0.64
121 0.68
122 0.71
123 0.77
124 0.79
125 0.81
126 0.83
127 0.85
128 0.86
129 0.88
130 0.94
131 0.95
132 0.96
133 0.96
134 0.95
135 0.94
136 0.91
137 0.88
138 0.8
139 0.69
140 0.63
141 0.53
142 0.45
143 0.35
144 0.31
145 0.25
146 0.21
147 0.22
148 0.18
149 0.21
150 0.21
151 0.22
152 0.2
153 0.23