Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4NUJ7

Protein Details
Accession F4NUJ7   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTAKIRQKGKAKQADKQTKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MTAKIRQKGKAKQADKQTKKIDLNRPPKAQHLDCMHRLNFLYQAAHLYTSQQRTPIASPYTPSIAGIGRMFGHQMKHVAKKLVVRLDPHVKRTICKKCHGALVPGISSTVRLDDTSAKKVDITCLYCENVRTLGINTNYTLFNDKNEWVDDTLEVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.79
4 0.76
5 0.74
6 0.77
7 0.78
8 0.77
9 0.76
10 0.79
11 0.79
12 0.78
13 0.71
14 0.71
15 0.7
16 0.62
17 0.59
18 0.57
19 0.55
20 0.55
21 0.59
22 0.52
23 0.46
24 0.44
25 0.38
26 0.32
27 0.26
28 0.2
29 0.14
30 0.16
31 0.14
32 0.15
33 0.14
34 0.14
35 0.17
36 0.2
37 0.21
38 0.2
39 0.2
40 0.21
41 0.23
42 0.25
43 0.23
44 0.2
45 0.2
46 0.21
47 0.22
48 0.2
49 0.18
50 0.14
51 0.11
52 0.12
53 0.11
54 0.09
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.13
62 0.16
63 0.2
64 0.22
65 0.23
66 0.23
67 0.26
68 0.29
69 0.3
70 0.29
71 0.26
72 0.29
73 0.38
74 0.38
75 0.38
76 0.4
77 0.35
78 0.36
79 0.44
80 0.49
81 0.43
82 0.47
83 0.49
84 0.45
85 0.52
86 0.51
87 0.45
88 0.38
89 0.37
90 0.32
91 0.27
92 0.25
93 0.17
94 0.15
95 0.12
96 0.1
97 0.07
98 0.07
99 0.08
100 0.15
101 0.19
102 0.24
103 0.24
104 0.23
105 0.24
106 0.24
107 0.28
108 0.27
109 0.26
110 0.24
111 0.26
112 0.28
113 0.28
114 0.28
115 0.25
116 0.2
117 0.18
118 0.16
119 0.15
120 0.21
121 0.22
122 0.23
123 0.22
124 0.23
125 0.23
126 0.23
127 0.26
128 0.19
129 0.19
130 0.21
131 0.22
132 0.23
133 0.25
134 0.26
135 0.23
136 0.24
137 0.21