Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SWJ5

Protein Details
Accession Q8SWJ5    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
159-181QYDEKLQKRKEMYKKICKERILEHydrophilic
195-217LELRKRCEALKRIKELHKGRQPRBasic
NLS Segment(s)
PositionSequence
120-136HKKTLRARGKLIRAMEK
142-151KQKMESRKKA
193-217KALELRKRCEALKRIKELHKGRQPR
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
Amino Acid Sequences MDFLSEDGDVKGLFDERVRIHRRDVLSNITNKLGEVPGPHGQESGASDAGTSGGKEIVVQTVSKDVTGPRGEGRGKVVFKDFIGDSGEEARAAKFEDGEDGKAAMLSRIQKEFEELKEAHKKTLRARGKLIRAMEKEVSEMKQKMESRKKAEEESLRRQYDEKLQKRKEMYKKICKERILEYKRRLDEAYRAKALELRKRCEALKRIKELHKGRQPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.18
4 0.28
5 0.33
6 0.34
7 0.38
8 0.44
9 0.46
10 0.48
11 0.48
12 0.47
13 0.48
14 0.51
15 0.49
16 0.44
17 0.4
18 0.34
19 0.32
20 0.24
21 0.18
22 0.15
23 0.18
24 0.22
25 0.24
26 0.24
27 0.22
28 0.21
29 0.21
30 0.21
31 0.19
32 0.14
33 0.11
34 0.11
35 0.11
36 0.12
37 0.11
38 0.09
39 0.06
40 0.05
41 0.05
42 0.06
43 0.06
44 0.08
45 0.08
46 0.08
47 0.08
48 0.11
49 0.12
50 0.12
51 0.12
52 0.1
53 0.15
54 0.16
55 0.17
56 0.15
57 0.2
58 0.21
59 0.21
60 0.25
61 0.26
62 0.25
63 0.26
64 0.27
65 0.23
66 0.22
67 0.24
68 0.19
69 0.14
70 0.15
71 0.13
72 0.12
73 0.12
74 0.13
75 0.1
76 0.1
77 0.09
78 0.07
79 0.08
80 0.07
81 0.06
82 0.06
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.09
89 0.09
90 0.09
91 0.06
92 0.07
93 0.09
94 0.11
95 0.12
96 0.13
97 0.12
98 0.15
99 0.18
100 0.16
101 0.19
102 0.17
103 0.22
104 0.3
105 0.31
106 0.32
107 0.33
108 0.35
109 0.35
110 0.46
111 0.47
112 0.41
113 0.48
114 0.51
115 0.54
116 0.56
117 0.54
118 0.51
119 0.45
120 0.46
121 0.41
122 0.34
123 0.3
124 0.27
125 0.26
126 0.23
127 0.22
128 0.19
129 0.25
130 0.28
131 0.36
132 0.44
133 0.5
134 0.52
135 0.58
136 0.61
137 0.57
138 0.6
139 0.6
140 0.58
141 0.61
142 0.63
143 0.56
144 0.54
145 0.52
146 0.48
147 0.48
148 0.51
149 0.5
150 0.52
151 0.55
152 0.61
153 0.67
154 0.74
155 0.74
156 0.74
157 0.75
158 0.76
159 0.82
160 0.85
161 0.86
162 0.8
163 0.74
164 0.72
165 0.72
166 0.71
167 0.7
168 0.68
169 0.7
170 0.68
171 0.68
172 0.6
173 0.53
174 0.53
175 0.53
176 0.53
177 0.47
178 0.45
179 0.42
180 0.44
181 0.48
182 0.48
183 0.46
184 0.44
185 0.47
186 0.5
187 0.53
188 0.59
189 0.61
190 0.62
191 0.64
192 0.67
193 0.7
194 0.74
195 0.82
196 0.8
197 0.82