Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G0I8

Protein Details
Accession A0A6G1G0I8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
96-116IIEHEKKTKLHKEQKEAADSRBasic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGSDPKPHAPASAHPHANNIGGGHHGMIRYPKHVWSPTGGWYSQPANWKANTAIVLAVSSIIIAFTWKLSAEREVRYKMPDPDRFYPSRYWSKQIIEHEKKTKLHKEQKEAADSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.45
4 0.43
5 0.42
6 0.35
7 0.27
8 0.18
9 0.14
10 0.14
11 0.12
12 0.11
13 0.1
14 0.1
15 0.14
16 0.15
17 0.17
18 0.18
19 0.2
20 0.25
21 0.27
22 0.27
23 0.27
24 0.27
25 0.3
26 0.31
27 0.29
28 0.24
29 0.24
30 0.24
31 0.23
32 0.27
33 0.24
34 0.23
35 0.23
36 0.24
37 0.22
38 0.22
39 0.2
40 0.14
41 0.11
42 0.09
43 0.09
44 0.07
45 0.06
46 0.04
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.06
58 0.11
59 0.14
60 0.17
61 0.22
62 0.25
63 0.26
64 0.3
65 0.33
66 0.36
67 0.42
68 0.45
69 0.48
70 0.51
71 0.55
72 0.53
73 0.52
74 0.5
75 0.49
76 0.52
77 0.48
78 0.47
79 0.46
80 0.49
81 0.52
82 0.56
83 0.6
84 0.58
85 0.64
86 0.67
87 0.69
88 0.69
89 0.72
90 0.72
91 0.71
92 0.73
93 0.74
94 0.76
95 0.78
96 0.81